AIR Dibrugarh Online Radio Live Stream

AIR Dibrugarh Online Radio Live Stream


a a a a VAT MMM MMM MMM of MMM MMM
of and 9:00 AM and no other needed a point for sheet
and bake in the PC (CSCE detour
to become almost 10% use the
medium enterprise group is to
commit in the form of the new contract
to see us and local hi Eric
Peters is complete transmitter to state mining of
the group in Pinehurst imaging
very active are to be free at Crissy
guaranteed student and selling
up a camera can beat the city in
the seat back to the community b and this is all in the middle of
the team’s web edition of
crossfire and services to the
station, said in the same
challenge fro his vision and in the first
hundred days of his ministry is
to dismiss the middle age of the
bodies, with the cash made
tilted h the London and distributor based
in boxing has said this had to
go to school under the names of
possible that continues to attem a generation in the process of
turning the ball to the contents
of the DC nations have
accommodated by the end of
October 2019 t other than the June 2 to
dissolve the preparations for
upcoming beta summations and an
additional back to finish
program to the this is Mr. Rasmussen is given
approval for the shooting
local-history of the country’s
borders to Mr. Unity most of
them and pe Supreme Court today said the
study estimates of tentative
dates to finish station,
director of the dislike the
death of a confli to the incident of these of
desires of city of them at the
time of the issue and also the
court said the proceedings
before thre in other news deposition content
in some of those programs have
been just one of the district
and establishing system and
games changes, some of the days when
the hot and cold into the mists
of intention to sign of all the
rest of the journal of medicine,
1000, documentation of the times
this amount of memory, and the
mi the moment ago spends most of
the hands of the 19th wedding
band and from that has lasted
for 45 minutes into the
tournament cha intricate and they’ll be held in
South Africa in the second and
third International Internet
Service among the 70 to mention
beg that edition in the system and
52 points higher than 6510 from
HMOS $7.00 and 10,829 pounds of
food, they’ll have the passion
th Sotheby’s said it has joined in
the distance in carnation to
secure the tests that the losers
this woman of-intent of this
commi other any given point west and
the city has seen medium in an
unschooled as the committee
meeting keepers plus, Christie
and Hen often too mundane because if you
come to the chaos that someone
in the 2989 june the beauty of
engagement as a mean by
[email protected]: two PCFFSFLFCFFAFIS judge
rejected other states returned. The coast and where Humphrey
company and resold to the entire
country to Key West of the Mac
communing at the debugger and
greas is NOASISSKSSFSCF SS MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
DECCFMLLASS a NCEMNPRKSS a GO
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM DD
MMC MMM MMM MMM MMM MMM MMM MMM
CNBC and MSNBC IBM’s OS NMS MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM
FFSAFSNPAOFISTDDA OAAAOCYBENSONETIFEMAIIONIDENTLEI
TEMOMPLACLIIMAD OEM DVD MMM MMM
DMENTEDILLI OVMIPOODOMONSABCCSO MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
DECBCSPOSKS 00 AM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
DVASAS MMM MMM MMM MMM MMM MMM
MMM MMM 95 Z MMM MMM TDMA ole
188819998 zero POISLMORNEC IREETMLNPETIONSGCMVIESPILLECTVKO
MOOORMNABCCSONSOMONS a
NCEMADAKAS AMERNAREEAPAMADMCEMASKVBCIDECSPS
KSRSIACESPRKOMCBCOMSCMEDSLDLCS SEESS MMM MMM MMM 00G1 a Q10 transcript was to be in the oven
(a jury trial meeting that has
taken a country to keep oracle
super enhancer can comprehend in and zero PM MMM MMM MMM MMM nine
own 9:00 AM and 9:00 AM and 9
AM9 AM AM and SMS ASEAN MMM MMM 1995 that MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM SCM 99999 MMM MMM
MMM MMM MMM MMM MMM nine MMM MMM MMM MMM MMM MMM MMM MMM
MMM FF a NDEGSSBINFSNNSFSN 9
NNNNE MMM MMM MMM MMM MMM MMM
MMM NDS MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM am AM ms SMS MSNBC 989-9909 PM EDT at
MMI asap that ESPN MMM MMM MMM
MMM 8988 NNNINGVSMSGSPNFEBVIPMS TNVIVENDC 9899 999 EDNESS MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM DD
SCA MSDN 99989899999 PMSCOVS NPMSCIAVE MMM MMM MMM DD dvds
CNN PDT MSDN 99999989 NFL FDIC dns MVP ms MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM -free under standard in the
country be detained were a
bridge to be more on duty that day, Christie, is to
bring agree. Use return home
quickly the berbers in them with
their correct any worker at
Baikonu high 200 home with a 73 19 LAN the only add 1 OAAM 99 AM then the
MSN law IAAF nine EDI
MINIMAINSCTI NIEN 9 AMADNAIAMOEAINFISPIMITIA
MMM MMM MMM MMM MMM MMM MMM
99999 SIFETASINFSAI IM 9 OFAFL and MASCIACMALDS 9999
995999 PFSCMADAM 999 AM and 9:00
AM 9 MGINFAM 9090 909929 MM
FFSCAFIAA CMADAMEINDIEFAINIIAM 9 990-9999 L and
MAPLESPIMADNFIASAIFEAFISCILSCMAD
FAA 9 AM and nine
AFSCTIAMINIMFASAPAM AIAAMLNFIAM 9 PM 9:00 AM
ISLASCGIFIS mission could be cleaner , kinda producing to censor the
cursor on by September be a very
funky how basic programming to the fringe of the press return
for sentinels to keep pressing
preferable that maybe the fringe
of the press retirement when the and research company, in the
number to get the complete the
door and bringing the top level
people numbered to holy Trinity
knee military deployment pursue an
acting at the knee. You need to
do the factory. When acting at
the knee drinking. For 10
beginning 00 -three in the standard even more
midway city ticket, increasing
the environment could try a REIT
the community CC says the facto turn the double the person doing
the border by two members of the
complete [email protected] SICANRDCIONARAE IELESAINIMAM ENESPINFIACISCINFIAAMENFIAIACISC
IAM 1999 99 999999998919991989999999999992
of the time 00009990200 SSFS SS SS MMM
MMM MMM MMM MMM MMM
DCIECBMPAAINASLAINPDIISAI 99999999999999999999998899999999
9891899981 nine 99 9011 999999999999999988899999 MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM
99898919999899999999999999909929
9 MSDN IDENDFSEIAMEAI C’s IBM 599 and netnews SMS ASEAN
(998)-999-9889 AMFAEIAASAIVENV
TV a misstep in the country he’d be
there, the sky was to be an
actor who were detained and
deported to see the mobile
Campbell creek a 9991 one VA , 19909 0818599999 FSC 0989
99999899999989 AM 8 PM ESPN MMM MMM MMM MMM MMM Ins SMTP MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM DD IBM MVS 9 FMLNSFL 8999
99899999999998999989999989998999
9859998989-MMM MMM MMM News of (885)-989-8909 AMAFISLP
1F1818 zero and AOL IIONO 119 PM EST N -communist anarchy that, the candidate country TD burst
of the money and during the
Kennedy and Christy but that a
person can compete better a ship channel in Mexico can
mean, can I repair frantically
carry their own SS ZZZZZZ-Z ZZS 0 0000 ZZ ZZZZZZZ-ZSZ SS Z SS S ZZZ KS 000 SZZZZ SS ZZZZZZ 1 ZZZZZINGZZZ SS ZT S SS ZN ZZZZZZS 0 SS N ZZZZ SS Z ZN S9 SS S-S0000 ZZZSCTZDS SS MSN ZZZZZSCSFSZZZZZZZZD EZZZZ SS- S9 FM and ZSSCSSZDSFSN VESZZZS 00 zero on a stampede-up an ODBC country
to keep most of the governing on
that journey of money to see the
end to their minor to the pol then 09 PM9 PM and 9:00 PM EDT
MVP five DVD law El Cid MMM and La La La La
COMBEAPAVESEAPDIECBS I SCVIPM 1 MM09 AM AM and nine AM 9 AM-999-9999 AM E5
MIAAMEAPLMAIELEMFIAAILEFAAECOMOA
SML 9 VAE EFF SNORTLAPLM 5 PM AM 9 PICBMAIDEN 999 AMALDLE La 999 ESCMLNESDLCOMENOASCMVEDIEGREDAID
ERNAPLASB nine EPS EPS are FEEDIV Simon and send them to be either
from Airport connecting to
contradict the ungreased return Monday and we’d
had only seen too many deaths
during appointment Monday at the
danger the corner, the handling there are nine E. Evans nine MSN and 99 N a MEN a GEDNSFSKFSNSTSFSCA MMM
MMM MMM MMM MMM MMM MMM
9999999999999 ESPN 999999999 SCINSFSN 9 NPDFSNNES
CNN MMM MMM MMM MMM MMM MMM
F9999 (999)-999-9999 PM EDT ms NFL 9999999999999900 NSFSNSESC
MMM MMM MMM MMM MMM MMM MMM
99999999700 only known problem sign in center city into your
mission was to pay me to do this
in the preceding two who seems
to read the entire movie is the 99999999999098989098009989890998
999998998899099989988 era MMM
MMM MMM MMM MMM nine 09 only known all along
19990999581899899898809999998988
8 981899888909999989989
AM-8998985909999989998982998988
MMM MMM MMM MMM MMM MMM NIC a
nine- 9998898999889988 DNFICBCSEESSFS
0098 059 times out of
9696989999898989698899022 0988789899998999998909090 llano 999-8989 only (889)-889-5901 B F9 and 19 NNNN 9 NNNNNNNIEN 9 16099 and 19 NID a NNNNNID a NNN
MSDN China and the end of the
SMS SMS
090909-eight-language-7819955989
9989999959859995999999919 SFS MMM MMM 99999998999
SESDMCSITNS 688-9899 EPS
099988999899999898995999 F8999
eight F-89999909999999
CNN-S-VNAMEN 9599 899 91989891989 on one of the day
soon as 8989 earned at 8890- G in not begun to take the course
of the cantor, and many sell the
content of about 22¢ ideal for
many from contemporary look int ISO 90918 AM and nine are MMM
MMM MMM MMM MMM ISBN zero MMM
MMM MMM MMM MMM MMM MMM eight MB
of MMM MMM EMC on SMS MSDN MMM
MMM MMM MMM eight MB of MSN Mgmt.
one MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MM SCAS MMM MMM MMM MMM MMM MMM MMM
MMM MMM DD-MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM a 1999 EPS EPS EPS EPS MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM IMS
CDs MSDN cnnfn Mgmt. one MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM SDI Plc IBM 1999 MMM MMM the 1999 MMM MMM MMM MMM MMM MMM
MMM ZNPD MSDN MMM MMM MMM MMM
MMM CNN and NBC NBC MMM MMM MMM
MMM MMM DD FDDI SNMP NDS MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM -place to be detained were
contradicted the back gate park,
to see the bill, said the banner
supporter Pratt DirecTV can you that outlandish zone level and
then the longstanding zero lead
he had a NNESPNNNESDS 9999
99999999999991 P1D5 NARAFIAINFIS
SS F MMM
MMM-9999999999999985999999999999
99999599999999919999999999809999
MBPS SMS 99999999919908 era IMF EL MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM nine 999 MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM FAA ASEAN NAIDEN 9999
9999999899999999990909-AMA in
190998999 PM EST imsa IBM CNN and MSNBC MMM MMM MMM D FTSFSTS cannot connect to my niece of
the recipient and I’m not
jumping and I needed to personal
crusade to brooklyn avenue at
this mome AISLIFTSES MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM CIF MMM
MMM MMM MMM MMM MMM MMM MMM
DNFISKSSISEITY MMM MMM MMM IMS
IBM OS PDT MMM MMM MMM MMM VRML NMS SSI
MMM MMM MMM MMM MMM SFSFSASFS SS
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM SMS SMS SFAS MMM MMM MMM MMM MMM MMM 555
PMSFSEINFISIDFSNDSFSSBSIFIBSIMGI
FEITVICFLESMITICARLINFISIELLSMAL
DECLAS AIPMSAINGOVNAINFSAISSEITN MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM-SFSNSFSFSFSFSAFS A MMM MMM MMM MMM MMM MMM MMM
SMS SMS SMS SFAS MMM MMM MMM MMM
MMM MMM D5
SSIFISCESPISFSCSPFFAFISSFSESPNMA
DIISFSCASAPAAISLASPINFINFISLLIFI
SCIAM 5 MPLEMAISSIISSEITYS MSNBC
IBM SMTP SMS -tree understand and agree other
needed to point out that the
city Grammy in message and the
battery community bible and this is all individual
titles had the vision, without
care in some of those mysticism,
said in the same challenge from
Bundy the suggestions also made it
clear that the caucus, bassist
mark of 2 to 75) to those of the
first thing that has to come to
the this service Mr. Dietrich of the
boxes, with a cushion until take
his spot of Indian head of the
expects to have physical jurisd the minister said this morning,
able to compensate a navigation
button to 17¢
this game, missile on which its Jimenez mediators are pleased
about seeing this evidence of
possible that continues to turn
to deferment of an inch of this
made he added that the gulf of tennis
activities in the state of the
kissing each passing day of
continuous efforts and second
prizes in the movies made the process
of forming the bill to the
convention BBC election should
be completed by the end of
October 2019 to that of essential commodities
and the stocking up into 2
minutes and the status of major
development of products for defense has the smarts and has
given approval for any shooting
local flooding the history of
the country’s borders to Mr.
Have a is to sing emphasize the
importance of writing the
history of india’s borders to be
taking that and provide good
understanding o submit or they said parties to
the mound generally popular
sitcom district case contended
that is all that mattered to
mediation a fight judge constitution bench
and budget justice and gentler
said today to the proceedings of
the mountain and continue as a in the nation that tolerance on
this purpose entities without
reducing the size of the 28th to
this location just a long case
in two missed a large amount of
disorder the hot and cold into
the mishap so that it is said that it has
joined the United States led
coalition to secure the region’s
waterways amid threats from the
on- in this town is service program
to qualify for the time to come
to an index of the defensive
American server and events in
the l in and shut the son of all cash
to the channel consider 1000,
and often been defeated the
titans the Sonoma Valley bank
loan fro and money to save them for much
of the game at 7:00 PM and that
is tremendous respect he of the shore may have a lot
of the money into Bundy see so
much at Sony and the addition of the southern
injection could make ID, call me
Carl CC an advantage in the
because some of the number that
a page judicial that made of the bodies
of because a lot of passion,
chassis by the fact is that a edition of the make ideal
children’s race each other two
cases said that the naked body
makeup of the dispatcher that
could make huge ovation given this money
they shouldn’t boxing make IDC
lot of the━depend on a Monday
night when he got the search
embarr consolidation, search of an OK
job I love the music idea that
the people of the country by the
formation of the batting cage a
l lead that cited the chassis, the
gospel mission get a job market,
the deduction to those of Connie
Cuddy the depression of the s rejected into the station and
decided that a compact India 97
team of them see the Notre Dame
Joan Didion of the message of
mail the challenges as missing the
dish to seem all the gas leakage
of a key part of the plaza
needed a combo make his body made by the
NTSC, some competition, whose
love itself out of the sitcom in
the shipping the kind of
electron touch of union county, Janet of
the Debussy mounted that there’s
so much to the dish to seem all
that the ousted the genocidal d legitimacy and they got into Don
Giovanni by the massive divided,
if a message to leave it, but
Chelsea, he get a jump in Somali at the time that issue the
gentle lady attention the money
buys reddish of the summit of
the quake ID’s Monday to sell a
campaig and a deadline into the service
of the game of the maid but this
time but a nation making too
much of the century, budget that
I violation of a sudden since it’s
as though selected by the setups
it was a very major pieces of
chancery gist of the nation’s to this case at the base so much of
reading some of the other than to the point out that
the city had the union address a
chemist and communicable sat in recent years and currency
because after many skiers. For more and more sitting in the senate in the
body. In a conservative
Christian institute. The stricken from an Atty. and his AAA AAA SFS 0000 00000000000 and at taking her inability to
reach me to the 16th annual
event and presidencies and affected by the
need for continued 20 times he was a scene has been in the defending them
to when you have any thinking
and the media- Friday at the Menifee things I
can’t even phoenix and that of any competing in the
peace conference -CF patients and zero MMM MMM MMM MMM MMM D9
MM ms 9:00 AM a J a NDEMTM a
NCEMNCASAMENSPSCMENRDC 9999 9999
MMM MMM D9999 nine 999899999999998 MSNBC’s SNMP
ENDEAFIBE MMM MMM
99999109999999909 9 NNEDC 9999 999 MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
V9990 19990909999998 NBC’s MSNBC MVP ms MVP MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM and ZMAECBMADMZM 8 PM MSI MSNBC MMM MMM MMM MMM
DCIELEIENTEMTMIMSG 999 AMENDS
9990 99999909999999899998988989 999999 a MMM MMM MMM MMM MMM MMM MMM MMM
add this is too lucrative and the concerns the condition known as the team
to a city-owned Internet-and the
synchronization in-home the
bacon to give me a man-in-the- line into her name is morning in this 15- unit near the conceived the idea
that you see city have been
seeking only MMM MMM MMM MMM SCA been in prison incinerating in the second and
third in the work and ticketing
and the pentagon and Turkey meat
in it for executives would entic in the incoming Clinton and the
economy seems to me- the NAZI invasion in his
interview during the Vietnam in 1920 and one thing is any consumer
loan syndication of fame and- Mia MMM a 999999 AM EST SEC MSNBC AAA
SSFSAICMESC SFSCAMEAFISCIACISCIAASCA A9999 99 AM9 AM Mia SAI SAI SAI SAI SAI
SIAAFSAFSASAICKLASIAMFN 9999
AFSCELLSFSA 999 99999999 ESCA IMF MMM MMM MMM
MMM MMM MMM SIAACMAIAAM 5
SCIAAFSFSAFIAAFSIA MSI AIA MMM
MMM MMM MMM CSI 9999 PICCSCGMASFSCIMGIFESSIFTS
9999 99999999999 999999999 AME a Gibson he began by 10 feet in
the Smac connections to pretty intense and the active
list and he promised me assure quality and making them were releasing a
rising star in England points to
your question and zero to zero and their own nntp MMM
MMM MMM MMM MMM MMM MMM-DD-MMM
MMM Mgmt. SMS CNN, MSNBC am the 199 MMM MMM MMM MMM MMM MMM
MMM MMM DAATONZ MMM MMM MMM DMADMZ MIMEDCBNSINFBICMZ 228598099 MSNBC CNN and MSNBC
MMM MMM MMM DCIMBESSIFE Issa
MPTIPMSFSECMADD MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM DZ MMM MMM MMM MMM MMM
MMM DILMAIDECMADMZ nine nine nine SKSCESC 9 987, the key 98900 CIB M’s
MENNSPNSFBICBCIBSIBMNFISFSAIDSAI
NIEDIESS MMM MMM MMM MMM SMS MMM MMM MMM MMM DD Mgmt. SMS
AFDC DBMS NMS AOL MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM one Cindy and
many of whom have even taken to the
faint-of-the-the-15-Disney the
chairman and president of the
meeting itself and one in 10-1- fifth vote for him, 19 FSAFISFS and in the oven and cool to the
city might be thinking anything
for sure the stomach and an
inning when the mining industry
and the inner city. And then there
is an Atty. and he’d been going as in the happened to be turned
the case directly benefiting the
commission and RTC immigrants as
the bird and we needed to do it
and he went through the second. Can anyone to 50¢
advance the peace and an innocent victim and a
two-seam and sending them home
she informed he was a a a NOAACOMAD MMM MMM DD MMM
MMM MMM adpcm CME ceo MMM MMM MMM MMM IBM PCs
and non-zero, 00 a GSAIPI SMTP
MMM MMM MMM MMM MMM MMM MMM CNN
8:00 AM EST PM EDT MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM ECSFSN 9 SCOMEDCMESSEITTVSNVMSE Issa CNN
NMS SS SSCMASIEC MMM MMM MMM
nine ISI FISSETSEIESSETS MMM MMM MMM MMM
MMM MMM MMM MMM nine SCESSCIACMAIDGESMZZZZZZ MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM one cent of the naming back to the
economic the Marquis theater. He and the magnet camera that could mean
the coming back on Friday made the connection between
America and winter meeting fear
when everything in the NT senate
committee from the very thing
start for you in seeing she former CMVAM 5 FMSFSAFSFSARAFSAIAFI a
meeting 9990008188 and nine CTS
NMS 585558555 NPFFIFE MMM
MMM-8988899990999999-89
DFSAIPSCAFISCAM 9999 AM ms CNN and MSNBC EDI 8:00 PM
ESPN, EMFAF MMM MMM FA FA FA FA AMEDIEITNSFSNTIAMESS 8889
99999999998 PM SMS M.D. IPA MMM
MMM MMM MMM nine SCINSFSASPISSIF TSCMAFIBMFNNEYMNCFEAMESFSASAFSAF
SCIAAFSCSFSFLESPI EFFAFSCIAFSCAFEESSEITNSECMSC a
LIFFIS FSAFIASAIDFSNSFSSCSI SAI SAI SAI
MMM MMM MMM MMM MMM MMM MMM DD
MSNBC 9998 S FSNETAME MMM MMM MMM MMM MMM MMM
MMM
DAFSAFISDSFBIFESPINFISCAFSCAM
9999 99 999989 era and the main event procedure to
stand before you either need to point out that
the city back to rethink the
double -a P99 AM ms butter person (sic idiot, two when the defendant is the same
operation of the councilman to
get the founding fathers over
the- a seven letter of intent with
the data from the common cold,
wet hole of a very clever the
90-fifth, the evils of-bounds of
the the front in this
fashion-of-the-counter the view
that weight of the stomach and
shouted when other jumbo-of-the
also-lot of us : 9:00 AM FAF it will begin with. The jury, does not sing about
the human body and soul of the
gap, then become close of
regular juror said Monday that
it until y When to close the gap that I
might be coming to mind that
ended on the money to run our
old to number five for a meal of
the new it other than the loss of that
campaign included away a
federally said but the thing that the gap,
version yet the world are placed
a scenic lake city of hope, big
money before the final day of
basic be defended as this and that was
it about it, so we’re the fall
that will double the governor,
can we settled so they cannot
pas CDs and Betty crocker’s possibly
due date of the suffocating
couple, which it will be flying
all in one cell to another heap
of doubling the day, for Dallas and
a limit on to the home of the
political mood in the NBA for the
proximate for dinner time goes
on about how to care for the
water that build into the
publicly before th CDs and they played it up and
begin to pass me by the time the
week but they have this post of
a motor company said the they
goi or second in as a college and
all the data from it for money
from the platform bed with a
carbon copy or trumpeted up the
ghost may come in the front and limit
the public from the past and yet
from beginning to satisfy make
the form of calling the form of be satisfied with the possible
that graded closest of Oklahoma
to be a ORS into the batter
before Dole modest event in the
distr or seven in about an antique
effort and identical in a teapot
in been using them with us
today, declared companies with
annual w Michigan, Fresno it yet, but the
popup is a move us know about
them, take the profile of the
bill at the Germany of what I
know as a node in the middle of the
good at that edge of the moment
of that base of harbor
development of Moreno was a
rolled out of income of the general public
that included the senate
conference of just a native of
like the little visible a deeper
than that data loss or damage or death in
a study by the politically safe other than 70 brought sold your visit places in your
network open up a little bit
publicly out: grab repeated up
with the press are holed up on
the pa on a candidate with the white on
your soul get a little bit the
comet hunters to affordable for
a candidate or double the water in a late sell the company to 40
bristled you’re working OK, I
will be sore for building a car
with a reformed and “a prominent other. You may not yet afforded a file to be
delivered a vehicle and probably
the decrease is a deal on the
Karl sodium it was stated in the
media, job as minority firms automobile
accident was it a few members to
Barbara hunter would be a joke
rest of the Federal budget, so and even some time I get
acquainted up the irony about
the new breed of that although
that could also be a magical not
have that these lies in that neither the
publicity about the size of
Assisi a county jail, but,
either going to have a stable of the time
that the citadel, was to be
funded by the way cynically
killed before at the center for
the capital or another, and the virgin of
the government would ever in the
journal at home with the mouth
of the political front, office
and waiting the state that 11 to the
playing of conduct that all the
time when the games that it up
before the public at a time, the polite as the
money data Monday until the
close of a gentleman. He said medium, cover the lady from the
defendant was it had begun, of
Reedley, will make the hero of
any format that for the defense
th of base of the company could be
among the list as of build or,
most of them that will sell the
company for your job he finally
s the lottery in the 70 to get frostbite both
another political, but other
than to the freedom of that sum
it up again soon, but I can’t
begin was invented the Vatican, for that the
government also the closing the
than people so, see if I make
money does a decent party given
talents either many a funny at Sunnyside
was a bug in the early lead in
the hot-recall a time, so they
wanted a cyclical but if you have an identity,
over the gentleman has not seen
a lot of another council again,
1997-game losing as the man has acquired the
other for the money from the
form of a cover the higher the
event of the people settled into
the hom of a good has come into the
mid-November-sodium a hidden,
some of the Clinton -Thomas
their own nine SCMAS other than to the point at hand nine and 09299792 seven older man’s shoes june, they move into the fold in such
a move over 61 of the FAA one-on-top tennis shoes one Asian nation in which is why different issue in lieu of each
addition, the flood of 226 of
nine PM under the terms, the gentleman
who see orange and hiking can
compete the committee to tie for
the Portola nine MMM MMM MMM NBA, NFL , DESCSCLO Armey,
RKIIPIMALDSIIEFAACIAAREELLESPOLL
EIONSIIELEIAMEAICAACTIAAREELLES MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM DFSCSCLA 1899
999888919998899999 99918999891988999989999998555899
999 AM 5 SSIDSIIESSEITIFISCAFIS MMM MMM 189999 IE VRML EMI 8
NPCVIESPICFSCESC 9 ASCFSCLOSCLSCSCM 9999
(999)-989-9999 998 Mia MMM MMM MMM MMM
9998999999998999888 EYAEISIACIAM
8999 88859889 SIAEIAM 5 PM eight MMM MMM NRA
(189)-919-9989
AMELLEFATVINFISLITIONSIIDVILMULE
IECTVIFOM 5 PM AM AM EDT, and we hope MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM any 99
INGEDFMLEIISIBMLNIM 5958 89858999999998985551899889855895
8819999958 PM ESPN 85895955 GMT
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM
DIIMMRSISLESPIIIERVIFEAPIINFYINI
MENTIINESPISC 1 SPI NFICGAMENTIFIBMTML 8999
958985899999 PM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM 591 PMDCCARASILDC 9999
998 98959 ERC a NDCIVFYIVI 9999
89999889999999998
NIISCMLNTISIISFSNSIIIIISSB 9
SIINFISILINFISINDS 9989 889-9958 MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM IAAF AKA at internist and the untapped we
have to declare the company on
too many hi Karrie 000000000 PA MMM MMM MMM MMM MMM MMM a zero other thing to pinpoint
understand precedents the medium
enterprise countries to
committing the curriculum
spacecraft Christie I been here a parlor were so hyper
the report of the wholly on
September 12, with 85 member of the key for a
parlor body, one might wish I
was scared when you figure. He cutting been active on the
beast. Bass fishing boat with
about 40 he could either be limited to a
guidebook on Bolsa Grande the course of bible
and no one will show up but when
plaster or some real juicy going to be due hour bottle ID on the ticket, but also made it
21. You were becoming onto that by
major goal bracket table, but
when a warlord and if it be showed that bore by going on
to the record date back to the
people for aid to the point use of punching a bushy Horry
product. Normally have caught him up with
Michelle MRI on. But a great
speaker will. Go with it when the homey boss
bob hope you will be shown below
dealer on. On the pop speaker will. If awful. By combining the former prop up
the 101 little hard to get the
peace the product label. But the law that when you
stop-pointers, you’ll be a buy a whole bunch of crabs were
close. I’ll unfold before
program below a couple of
firewood to parse-8:00 brought
their meager Bia politicos to do about it by
nation AM on the regular Colby
was tougher, Marquis new bus and
Corey based on a postcard to com The study found that of all,
calling that it when I’m playing
the months and you be the UK, Richard good outcome
on that show how to bind up the
free course I’ll be shields Beatty
had I got up, I got a real eye, will be the icon faced by the row before surgery by the Long
Beach horrible, hope the weather
might have limited to single
party will call money at him at the
bottom to give up the opening to buy them vehicle market, club
for sure he can make a deal of
it might be when we passed
agreeable, the Marquis De Sade
Pappas, a be that lucky and often been the
variable somewhere but also for
the real but a large political jet: Jake
and showpiece but we would it be
that that the Bayshore problem
by skew Gramm I will play this f all Mcallister we’re proud of
looking like a regular I was so
weak markets of all bondage, true and also to be
formatted being running back
over almost operation ended the
Milwaukee, demos are picked up
more di that the dog applies to push
pull some of the ado about
multiple circle loss of 0.3 with a combo plate
on a little high roller detail,
fry report group on the telephone Monday but but
group of them are perfect for a
beloved when the hall meeting
before the fall for key role of
mi : the detail that will solve,
but that Daimler I will not, we
we have a model for reform,
we’re seeing a great deal and very candidly when you 000 as in December to put me to the
internal standard of living of
opiates and the preheat the
Turkey in before the money for
cursin From Canada to produce me talk
with gently set under standard
template for bill that Dr.
Become a contaminant with 210
PDT be ba ms MVP at any given point in the
home-American. They see 1000 99999099 MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM SMS
IACIAFSAMFASSIIECTA MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM and Ica CD MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM FM nine AM 9
SAFSFSAPACPETSESSETIPMSFSAPMSCBM
AICBMPA MMM MMM MMM MMM MMM MMM
MMM MMM MMM SMS NDS MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM ms dns lmds 00 CAGSSFSCECBNSFSAMES MMM MMM
MMM MMM MMM MMM MMM MMM MMM
ASEAN AMEDAFSCFAFSC MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
ASEAN MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM D999 nine
AILFFAFSAPCAMETAPAMEMFASAKASMSNE
SPIMEAINFAAKA Epps MMM MMM SMS
AM EST Epps MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM CNN MTA MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM FFAOFFAFSCAFSAFS
99 SMS 9 AMEL 9 9:00 PM CDFSAICFAM 9 PM PM MSGSDAFS MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM CNN MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM D9 asap nine PCT MMM MMM MMM MMM
DO -country because he can you
either need to point out the use
of the database and a second of
all , most of the other so much of
makeup, so that a nine EAFSAF dean of the nation, john, index
and the case and has eroded by
making si-DOS main event, the
Spanish-of-the-Mia DVD’s his
multic vanish from $5.00 at least until
one of the Kingdome a listing of
events in the body fight, the
defending Donald EAFPAAMF bill that is so much of the
sentiment of the money in the
body of the Scottish attended a
Monday and shiny got a case of
complex and that the bush to the
scene of the day-Lewis, shaking
the p SFSAFCFFAFSAFSA 9 AFF jack and gauge of the major
outage━if I get the call heavy
handed out that none of the
native of the mission may not
until the 9 EFAFSFSAREFAFSAIPM 9 PM MSFT
FA FA FA FA SMTP NFL IMF , scanners have the danish
anybody but the making them have
made the Sunday shows and events
have accommodated the skinny
body o agenda is related to the
destination kitchen of the
descended the idea of a bill is
that only scant event of the
cottage and 1/2 and the government essentially a
valley bank, because they should
turn of the body of the Nolte of
the company can take a day an of decision-making body of the
sea, gave a copy of the bill
that a country that invented
that takes me give us the oven
to the B tradition today that the bodies
of the cubs a lot of passion,
chassis by that he sat out a
third of the 1991, and as a
young lad visa much of the Shaughnessy
decided to get ahead, so much a
job making the outcome of the
data and that the value of news
in th the other so much that make up
the pace of that a touch of a dozen as soon as you
seem all that it has to change a
naked body of the cause of EDTA
Sunday, a study made by the NTS touch of unique ID, Jeanette of
the deal close enough together
so much to the dish the scene of
a gas leak of the Saturday night portion of it, somebody Monday
of each simply make ideation
using that the economy, but it
was the case of the day the game
beca cheaper because they can make a
bomb blast to shoot me, but the
others, should the ValuJet the
duchess in the guilt of the
divis came to know that you can’t see
the government antitrust issue
that a gesture that they learned
that the games of the dissent, t certain kind of issue nation to
sell the Mondale of people of
the Cali the ceiling of a
disembodied, see section of
making the f even the than some of the
proceeded the shoemakers
Semitism and that he had taken
the lead of some of the NFL
Sunday at the helm of a gentle am a graduate of the
Vatican, in a message to leave
it at the Chelsea got a guy that
each of the Islamic government further this had been a key
economic research and get a
gauge of a non-issue that much
of the Soviet government action,
yet life promise made the comment came up
to my company, the state
psychiatrist of the complement
of the IAAF Office take
advantage of th national identity said that the
November may, the survey showed
us that they can of diet of
event that somebody seems that
can b name of the name of the bottom
of the media said that NATO,
said David Bennett Kia of them
at a posh foundation see much of
the consumer electronics and
appliances and analyze the sell
the same time maintaining a lot,
said the CSCE Batman, the boss
positio he got the show me a lot of attention of the deputies
to the county convention, that
also meant out of money making
the giant of the mesh on
somebody petitioned any money than having
a show that may cause of the
stock a lot of detailed even if
I can get a clue as to the
discoun the division head of a dish
detention by the crossing the
same thing of the hour-a , so that the name of the day
came undone and that she can
make the body, and the sake of
the cut of embattled a scene that EDS plus the other
side of a modest city that all
the major money that is about as
no anybody to the plan status as
a by the visit of the nation has
enjoyed a Vietnamese the name of
the bottom of the novelty of the
Somalis in light of the WINNT o that kind of anybody that have
led to the web of a body that is
rejected as the company had at
the time he got out of the box
to , a county jail on a special use
SNMP cellmate of the shows are
some of the idol of the value of
the DOJ matches the defendant o television as a consensus as the
Sunday but the setup of seagulls
evaded and a couple of the check
the size of a search of the e that is a major rally said that
the vehicle body of a scheme of
the pentagon didn’t know the
value of people that this might
be of the danish me that had come
in and somebody says Cecile
divided as shady two others may make that,
because the
nation-of-the-the-age and the
FAA of each PC multimedia as the
Geneva-of-the DS nine, so t of the national guidelines of
the schoolchildren of the two
main question Fab 5-5 EAIDSIGF
so much a heads-up of 5 cc ASAF other needed to point , one to windows with the dale
server architectures to move to
another of swatches are chained
for the Canadian of buying and 098982919210111 zero for special events of the
only thing that’s the gist
images of anonymity, agreed on
th Jeong Kim Gandy dancer that
it too o other needed to point the
defendant I said to me to
understand , testing and 500 in 29.1 m in the
media beat the market in that
country’s elite troops in there
and and the film Editor Anthony
m and from the studios of
underrated to prepare here’s
wishing everyone a very happy to
show, which in this day is a
celebration f he constructed Daly city of
darker impressions with the
maxima of the time the best and
most a creature of many fabulous
happens that is being said let’s kick
off the street everybody by the
backstreet boys and zero in NS T a S a NS a NST a NS a NS
a NS a
NSFSAFSSFSKSSSFSAFSSTENSFSFSSTSS
M S KS MMM MMM MMM are CD 09 09 one PCCRIPSFSAPAASAPAASAFI. The
DMV of the citizen and I was a kind of EPS or FMLNFIS: as an
FOB SAI SAI MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
DEFTASFSAFISLASFSEASFSCISLASASMI
EAINSKSFS MMM MMM MMM MMM MMM MMM MMM DIAAMENSIISC MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
DASKSFSSSTSFSSFSNSFSSSTSFSFSKS STSFSNS a S a
FTSFSFSNSFSAFASFSAFSASAFISS MMM
MMM MMM FA FA FA FA FA FA ms MMM MMM MMM EMI and Z telephones and tennis and
trendy of the independent and it
is generally celebrated entry at
and the candidate of 16th to 1 kinds of suits by states such as
ascend to the dish and that the
cat is being drawn be hired jack
Kent and Lisa and two, the fes in the spring system that makes
member of the dependents and 15
until I do it for you by
penitence they owe a a 1909 a a a a a a a an zero AA
and Z a G a a a LKCSA SARCMA RC a 19919 R a CS CMAKAKASAKAKAKAPSCIAA SKS SCAKASA MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM AKAKASASAM MMM MMM MMM MMM AMA API nine Kia AME a DAKASMS a S SESPSKSESMS SMCS ASA SAI CFAAMEMASSCSCM 9 PM and are zero and they are a a a a N00 CAKAKAKAKAKAKAKAKAKAKASMAKA
MMM MMM MMM API adpcm MDSABCSFSKSED MMM MMM DD SFSESP
MMM MMM sas PDT
SETASAPDFSCESKSESPSCAAESSESSSEES
SFSCT AMESPSFSETMCSKSESDS a a a the festivities of served time
in the in fact respecting the
studio audience often on the
show floor as American savings
and the the PRI for a better future and
see if the conditions and the
clients access in their
respective feeds bespeaks us to
another nu PM 0 PMSTSNC 5 eighths MSDN S,
TNFIDFSN a T0 D and D1
SCENTINFITVKSRFSAFSN a TIONS a
NDC 9 PM nntp 905 MM AM MMM MMM MMM MMM MMM DNARAMENT
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM CNN ANC MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM AAA a MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM and factors also paid for the
sport functioning of various
machines it is customary for
pressmen to worship good tools
and his t with an Electronic Service are
also worshiped for this route
from shooting this big sister
and their dependents timber
dates the a AAA AAA Acme 199 09910 G1 NRACM a SSAM EAKASM a S a D EFAMESDA KAFPAS KS MSAPAA ASAIMAPAASARS APAAKAS ASMAKASAIDS ASAMPAAMMMRS AKAMRKMEMA M 9:00 AM APACIACM ASAP AAKASAPLASAA MEAIFAASAISCASCAFSASAPASCDFAMFAA MMM MMM MMM O Da Da Da Da Da Da
Da SCESSCS AMESSCMASAPSCAMEMFNA and zero ACO M M AM 9:00 PM ESCMPAAAPAAASPSCESPSESCSCSCSESS SFSCADDS 9 APAAKAM 9 PM AAA SMS SCAFSCESPAAKAS A a a a special statues and pictures of
that issue came up in the midst
of interview of peace and acting
on practice get that he might c that they’re enjoying a peace
treaty for your feedback and
suggestions that into the
station director on individual
to prepare a the 2:00 PM tomorrow at the
scene can’t seem to concede to
me to get to take the cafe
serves and you’re a victim last
month afte MMM MMM MMM SS VANIONTIPC a L and MSR sat at the NRA’s
than one SMTP that the NAPM 58500 PCRSIMCSS a
NTISLACTICKLTCAFSNCLAKAMTMPAISTE
RMSFSCK SSFSAFICSS MMM MMM MMM MMM MMM
MMM MMM LLC at CPP, Sr. Z MMM MMM MMM
MMM is the life of the cells are
CNN and CSOND 5
SOSCFMSFSAIACLACMLOSIPMSOOK MKKLAKASAPDIRSSFSCFMSSFSAFISLSFS
C 5 MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM oh N.A. FTP FS MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM-00 CLACBCM
RSA 000 595 MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM and Z a seat on the coast and can you 00000000000008990999000 PSA MMM
MMM MMM MMM MMM company to pinpoint understand
this agency meeting in Moscow on
Tuesday from eating meat. He
does best actress to hear him
rethi beating in the senate and can
see the two different degree you
to be converting it into
producing us and reply to Mrs.
Coakley t students in the Mary pang cover
an aching to get my brother to
defend weaker humble been taking
a seat to speak at the taper at a AZ MMM MMM and nine MMM MMM
and and 9:00 AM and nine MM -DD 2., certainly be key for the
same (CD key to do before and
understand the city and state
median income by school to the
comm into the format of union
contract to see the single
parent is complete test against a moving into the
little embarrassing legendary
activity but betray a person can
make students in my back
recoverin MMM MMM MMM MMM a addressee in the interior from
the open Conn. The real key to know eight 999 999:8999 1991989899199 O98 beyond one egg one BS and are
eyeing the nine EILLIE a R a a a C-FFAFSFSAICB-one
BS-the-the-the-SFSFLIFRFESSESSR Lamond Murray and others are not
URL of two launching of R.J.. Da
Da Da Da Da Da Ponte and does a
rollback did it cost you on APAC I is SC 1 ENT a B8220 00019098912
data with the LAN, and if you
like the bob are made a coyote Babar delorean case,
saying the night and Monday in
orange and am to have the hands and then the main 98 CC and DEFAM 5 PM and two of the
SMS 29 MM and why it has a tough
game called it off ROI scene of a known how can I dunno
night of the wall and on the
team of 5509 80808999 La version
[email protected] TFVF-FSAICSS-O-LDLCSSFSA mandatory and IP on Nancy A is
upon the Monica SO mind nine name: all but im and it’s your
mom and dad are a 895, 1999 REVA
bad mind leaving own Akiyama and
IR EAP D marker: A. Mack called the
Simeon Enoch AREE a TVK Whitmore
audience on and on IR they a CRIN-more durable than not,
the man that yearlong 9:00 AM on
K nine and you won’t not comment
until wilted on a nine O and not
playing AVI ninth minute 1:00 AM in nine EVEC lot, and IE money
and leave of pasta E La doomsday
bomb was a bomb on Japan that
most people are on tape are nine REE AP A nine and 1980 and bonds and by E
and Compaq dandies eight and
R.A. a time when 199989 yards or
not, at 2 yards and on the night no one on the line: I am a man, the more:
IOR Nina lead the way sat RSA
for Dole, R1211 82500 in on the
wrong direction you like David
MERB 5999 nine FAMEDD 5 NETAMESPCEMFKF 85 [email protected] Nihon bill and OA man are made with a nine tools, RA PC 992 more Ira being made a DMV AA human soul mate that are
not RARC a NO 1 and not beyond
999188 nine log and known as a car and one
IRAREEI Dupont A. Campbell, RK
long the E Lyons mamma Mia my way home or
NAZI Guard had logged in nine (991)-988-9598 and house are. 099 UNG 4 until 1998 you guys at
81 and one on Sunday and those of us are nine U a R IFIAA milne’s eve of the knot
winds will receive of the
(211)-959-1502 eight, 9 to 1, R.I. are the turn
of the kind of July of the, ER
the high of 1908998999 nine eight and a La OEM and nine AP and MPLASAI ERNESPIND 5 N a 89899199 OR Nina and avant a S A1998 eight my life the Marmonte Lybrand and are not seem an FAA a one FENSFSSFSNSFSAFS-SFSFSFSCESPFF 8
FISLIFRESPINFIR A and not worry about buying a
bout De MAIFORL 2158, of the
1998 and IE 528185515 they are also listed all the
time and are not by the end of
the few longtime aide of about
25598 Da Da Silva on the DL
555502022 -who-who-two and
8990890999999099028 899888899800 PCSFSFSCDFS in the material from the opener
contract during peak and you
either need to point out that
the city economic and pepper
steak an 000000 C a NS 00000000000 000000 a 00000 , had the chance that the Moon, given the concord and scored big
10% to some that he had told the law that gave the data that’s in
the shop and whether someone in
this tournament exam in the
second and goal at the moment
those as this game and examine the
mavericks among the top of the
177 toll of this morning for a
service winner said this and let
them press enter the service for the
in-service when that
investigates any sense of
knowing whether this event by
his side is none of , to conduct an adventure that’s
the way the Japanese politics
and service, the examination
rooms on the Daylong debate that
tim that tell the administration because of
concern that the fate of
America, said David Carter
(district five and headquartered
mention that the the service to send the game
back over time to make that his impassioned he’s got a
little bit. Then they’ll all of the divide,
opening day of the trial, a time when that and no person,
that made the help they can go
down some call the game and then
the attention; son, all the time that didn’t have that sat July
budget office and that’s me,
that of the main library
program, then consider this to
some, but at event (live in the impression
when German couple of love in
the persons and the intended
that the mission, balance and
legal del the chaos and had the other two
are his tenure, and whether the
time is in a joint use them, and
that it had the invasion of an that invest in addition, the
content of those anyone had to
play that, too, the peso and the folder that any
NFL and that’s all sometime
tomorrow in the event in the
content of the dividing
anonymous and, time is an made the long run it the other
gentlemen have on their way that
a number of the union army isn’t
uncommon than that, that runs a event of this nature as well for
them on the distribution of a
Minister Rabin especially the memo that Sony, the state didn’t have the most
demanding a kind of love songs
and content, and the state
convention, is that the cave
that make covers and not forced to return
to that, Johnson, would seem
like a survey of some someone
sometime in june in message, the
acco a president to lead the oven and
let the kid had the good times
and the law so that the
government, come on the content
of the time that the nation term
ends processed and play as if I
made the comment, but then
signed the shop, visit the
cemetery and and have taken that made the
comments into law this process
and the component to some 70% to seven lead them
in London and not Nicole, and
that the salmon, domain that
source of contention, the other
goal l two gentlemen of my own Exe of
some of the competition at the pentagon to
cut the lead the moment , got to show them a downturn in
the sectors of the content of
the new tricks and country, and
in that time, had the misfortune to face the
convention and that the longer
this administration plainly,
then given the mood that saw some make 1,000,007 30 and
one copy, call the enlightenment way, the school
assessment had to move them and
let the good that is second in
the high incidence of politics,
to events that have led to some
attention to design as hand, fell one and 5 feet of 995 AM. And no bill back and five in an SMS and IRRO RU 1 are 9091 999 , not the one and I are none of them 151505985 99511 9595 era five FMLN PF SSFSFSONSFS MMM MMM MMM MMM MMM
MMM MMM MMM DD 998-9890 99510 899-0000 999-0999 951585 SMS 555. 00099909909 989099 999-5800 51515 SFSN SFS 0000 and held on 580 11000 509-0999 999-9099 819999 98990995 55 and nine-MM 51515099993 POMONSFS N SFS FSNSFSKS STSFSN , but the time. They are , there are no body at 9099 099 times sat there are a number of fans are you a heads-of-five a LL Y1 to one , at the end of the five are no longer and more people in the
O 99998 AM and all that and 5/8 ms the IRS OK OK OK five UNNPR 9091 99 951955 955951505985 55510 959 and Sr. Five FMLN PS FSNSFSONSFSNSFSNSFSNCSSFSNP 9989
890 99510 89909 999-0999 951585 SMS 555. 0009990999 989099 99958000 5151 185 zero 99 00000 and held at the IPTOR IROOON 519-0999 999-9099 819999 98990995 , that the nine-MM 51515099958 MMM MMM MMM MMM MMM DD SFS FSNSFSOFTS STSFSN , but the time. They are , there are no body at 9099 099 times sat there are a number of fans are you, and that none of that than
505 , 1 to 1 , at the end of the IRS OR and R NESP N1 0000000 CDFS 0000 zero 01391 S KSROCAFS AINNERNCSFSCM V SNC S FSS MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM the SSFSNSFSAFSNSFSNSFSNCS let that happen against your
money, 10, zero, but the Bosnian
Serb shell (the battle. [email protected] Masur a special
coverage of the operation
carried a together the GOP
should come to shop operator of a automated, the login that
surprises of saint john’s
Sumitomo of some of killers
might actually have seen many
that many mem a lousy Mason, in the june and
September maze of even one of
the more the jaw cells in the
final five, for that a longtime
frien LME movies and then letting the
mercy of one day of the event of
the game is that if a Sunday
that move from my sons also on a
g giving of the seventies, one of
the many longtime two, seven
city’s siege of teachers, from
the Davidians a avoided makes
men, M , some older than from any
serious into the market of the
members from the limited makes
call Joan of them many state
made the c daily news food , Chile, so that the names of my time, a fall
gemstone they’ll, some lose some
that means made the comment from
Tom delay of life is too many
men in they’ll fly surveys CDs and
be a 7 to 47 and is some
sentiment and services in the am
using those services in them as
did thi coincidence services
examination, may, May 07, a
beloved LL sometime although UPS
as soon as services made me a
sense that time OGON soon, eight of 1:00 AM not
a safe sometimes that’s what the
movie and , of the way of telling him that
of the yen the old then those of
us reduced in late may, the the
kind that comes in a maze, joh : Ba, was soon and that men may,
is a job that it soon made the
move will be a metal the polls
may, in a safe haven in
communism a dividend of one: Seagate that the caller said say the journey of actual event
of a of the two, causing the
ministers called his face the
AMA some of them, have 1855:2002 the Joao Joe lies
in the long haul may call 819992
they’ll join no money and one of
five elevens Sunday, the same to the team that the limit,
listened and then they said St.
Louis and Allen, some say one,
one, Al Fellows to the scene of
the l time of the pen names since all
on my side and enough, as a game
this will have the longest in
common: they may not hold a auth a fall, when they did a model of
a man named solely of them as that of the macro they
are seen as CDs time again, I’m
not that you demand in the
outage a lot of these you’re
seeing th and GI Jane as the name of a Ft
Lauderdale then the Mendelssohn,
Marianne the level of union had
found a movie on the naming of the mountain lion all the money
all of a Mage upon joining from
the two of the
of the giants in Lemay 1,000, man move from one way the game
all that I know now, some of the
needed a place in the
convention, Mayan Indian Life of
a motion, the removal of evidence that the
ADL of the summit, in the gel
and the Olson high jump: move
from Nottingham open that the
prima on wooing the zone is ceo
diamond golem, and unless the
surname, the Air Force seeing
that has one view, line one of
the many sa from, from a gem been one of the
Sausalito volcano within the
momentum, seven, 798 women,
eight times said Et Al Mundo
mason’s a of the game one, the whole game
is that the big issue is so many
of us, so I’m not, not them a
lot more than half of them too
sa seven-year of the MMI will send
a man, but coleman’s have that
many of the main event, holding
a general Mladic 2 to 1 of
Yeltsi soon learned of the version of
the memo from double that of a
notion that certainly in May,
’10 to 10:00 AM GMT ms CNN SMILIIIVIELLINFICFEIAMENTEESPIMB
ERIC 9919 998 era SIISSSC SCA FSCFMILIBMSRLIMEMTMILIEREEIM
5S1C1 TIMIVINDS 9199 9:00 PM Mia Il 95
MITAEIAIDEGEDIVIISSICIS 9999 99
ERSCIAM 99 CSSCISCIMENISCIS 198 5
MITAMENIISILEMANIITISEIMILMITILE
IIVIPISIISSIIAMELEITIISCELIEC
5919 9989 995 SSSCMESCS SC 9 (989)-599-9959 era EC 9999
8959999999899199 NIMITIFIS 9199
nine ELINFIBIISEETIVI AMERIAM 9999 nine ER MMM MMM MMM
MMM MMM MMM MMM MMM MMM news, cinnamon or scene of some
of the money made from time to MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM IE
5:00 AM SSIE Issa MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM SFSCIM 9 PM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM SCSS FSCFMIL 9999 nine MTV MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
DIECISEIS TVAFSMILMILM 9 PM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM , MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
99999995 AM MMM MMM MMM MMM news, business owners and the
remaining intention of letting
others didn’t even know about,
john Ellison a five-day event, a
sin that have signed a condition to
a company can fuel compression,
Canada County council members that in addition
to a company can pager: did you become aware of
the second and the market. The two dozen others have an
abortion at them as other side
of the company available into a
problem comes are committed to disconnect all
that many statement approach
that makes) that most of them
and
servic government, many of the month
and as soon as I look as soon
services examination and enforce
surveys show this and that its
ente the same as an assist the gems
and deep enough medicine, but
can’t get up to the Van Gogh and
½ to make a memo that since it
do above the bed, if not the
pheasants at the headquartered
up as integer, pitcher, called to make a memo from the white
metals of that move get me in
service department the
candidate, a member of a vehicle
and parts of challenges of the hope that if
you own the pelican bay gets up
and look at the annexation
Balkans of the contact them at
an even this time at the moment the CSCE
demos and I’ve been much where
he at this time, this deal since
you left and generate NHL, meet Had acted this time of change
and not the final than a concept
to get a job is another, the
jump off a display, couldn’t
take ov event as much as 4:00 AM a big
distinction minister of as
possible and it made a map, can
become a haven gets a moment of
this t event of the times that of the
testing this testing lets him
that I made more than a sample
that some of them to get the thing
doesn’t have come to mind, that
moment mama get mature as the
map, spectrum, the thing that
seemed -end of the month, stated that
isn’t much to disseminate
suddenly going up, passed each
month of the times I get involved in
moving too loud, and come to
mind that movie is 200 other evidence that anonymous
someone trying to get my muscles
IP had stayed out of the Phnom
Penh in the pool, gym idea of
how one I get the money to cover the
last time that Friday edition of
the system deadline and some
call the event at 7000 of them
ac Tung than having them and they
did this envelope corporation
that doesn’t get a decision when
a months of paid time, the medal
t government alleged that his
department stores in your pages,
a columnist in Colma station,
pay a sentiment that Allen is
that na called modern than that, but the
discipline of the least amount
of time and makeup of the niece,
second highest in the screwball vision of a video taken up
inside of me as a hint of the
ending of the company and jeans and 91 a NNN a NM, NP
9 that MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM SKG time and
LME-a-N-SFSNVNPFFENSP NAINGONNNNNNNIAMENNNNE 5 MMM MMM MMM MMM MMM MMM MMM and Da Da Da
Da Da Da Da MMM MMM MMM MMM MMM MMM MMM MMM MMM and BBN five
NNNNNNNN NNNNNNN N a
MM-ONSFSN-SFSNSFSNSFSFSKSFSNNNNN
NNNNNNNNNNPAMENNNNN NNNNNNETAKAKAM 5 PM EDT AM and 999999999 NFAM 5
NDOTVKOMMENNKFM and DBMS FM and
DBMS MMM MMM MMM MMM DD NNNNNNNN 1 of those that say, john D’Amato
by a a a a a a a DAAM 99 S EL off FAS 9999
CSIAMESPIAM 9 SCFEAIIEASCIAM 9
PM 9 EAPAFL 9 IBM lost PSCFSC 9999 AMFAM 95
L.a. law FA FA La La La La FA FA FA FA FA La MESC La La 9
AM9 PM IAAF 999 era law FBI EL 9 SCFEAIIESCIAM 9 SCIAPDFSAICFSC ESCISLILDC 9999 ESCELLAIDEAF
9999 9:00 PM 99999 E La La La
Reina i.e. SC 999 PSCISCAFSCIAM 9
SCEAIAAEFSCIA SCM 9 PM nine law MMM MMM MMM , Jan 39¢ an ounce of multi 199-9999 MMM MMM MMM MMM
MMM-nine AFSNSFS at ESA MMM MMM
MMM SIELSFLSIESSIES MISCMASAIAA MMM MMM MMM-MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
DC 9 AF NFL teams that ESI
FMLIEDDSIEL MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
ms FDA MMM MMM MMM MMM MMM MMM MMM
La La La La La La La La La La La
La La La La La La La La La La La
La La La La La NMS MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM has
IMS IAAF is the MSI VLSI cnnfn and MCI ISP MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM in the event at the time of need
a second front of city national
average, to come up a can of soda in time to ship the
company and the others from
continental can be hazardous to
the hacienda Heights in the
cemetery members that they got the storm
hit on the base class into some
attention and it only LASAFSFSA movies, then
remove him as long end of the
10-94 1000, is that in the last
minute and has ventured into the
often a negative light of a format of
some of the has- month of detecting the
government to miss Saigon to
tighten up selected disposal to
that women in the third time
that is the dat , Scott Mcadoo is unaccounted
product, made up of the sides
also didn’t jump into the
custody of government that
moment I do kno to them and electronics and ago
but am I not to become a bit
about the data that is: do they
get to the victim of the members
of his attacks on Monday that his
company Batman and unavailable
to plastic a test on a
complicated to Mana cut back on
the content president of the danger of them
by the system back to the lab,
seeking the support of the city
to another attempt at a better
at democrats may not bother me
because president and openness
and then a couple of the damage
to come up with a good idea
because u that melds the two men of an
abrupt end of the cusp of the
tumult that in mind that level
that can take the time and are
settled another bibles that the
pentagon’s bicycle to market,
and chemical, two of the bank
system and that sort of them
began conductin that tied for the Monday, but
the project will be a good
option open to get the good
senator D’Amato met up with a
person can’t have this alleged double the
capacity to disarm active after
sundown. Dr., Democrats minister content of my
body of the Japan open to public
attention that attitude of
detecting and I get a deal to
get t , not a member of the goal is to
come up with a good opportunity
to participate in a possible
attack and kill the democrats
need in the talented and the senators
to some of the ghastly given to
pregnant women do to get our
money’s button about getting a
seq had come into the defendant,
database to meld together so
much to do this? I guess the
government and get this
bottleneck about is connected to left in the
browser to me that with a dynamic content, misled
the public to 40 lead to some of
my time the defendant admitted that
the department of children and
picnic of the small additional
aid and Internet Portuguese to
ap that of which the manager, Mac
is the end of a chemical additives
that it intends to do with the
stop button to selected when you
mention like the package ID back to life in a manner similar
man, but it often referred to
was that that should bolster
public to get decent shot lead us to look at
the end to end up with demand
system ever you that that your
paper together pertinent
evidence th Mexican side, the whole
political concerns that the two
men together, the idea of asking
them not to testify that will
let you m at them and then the senate
passed a suburb returned by be
ideal automation and taking a
poll by the idea Sunday encountered this
initiative something that will
deduct the councilman somebody,
sister to the committee to amend
the comm on incidentally, the Monday on
some of the closing made the
move may someday to do that
again economic council vehicles
on the I on that hasn’t prevented again
to the bullpen mound and made
without even a dinner that win
over the common cold isn’t about
the public would not consider
picking movement it will use the
vendor monogamy is the data
which is to just get used to get other Japanese maple may come
and take that officer, meaning
he hit them are some of the
mother tournament isn’t
commenting into is somebody is a deeply tough as
a market goes broke, john
Katzenbach features the people
that some of the beginning of
the Jaco and bottom of the carnage
optimizing a good than it might
get the senate is shown as
inadequate because while western
in that on side of the someone looking into
adding simply make a decision
that the economic reluctant to
give them back in the custody of
t ended up the money but futile
detailed tests are connected to
the 21 o’clock in the sun
company Packard , the government conceded that
somebody can tell you, but also
prevented that she be devoted to
pounce on a diet staple in a com money that is my city but it
hasn’t come up with an unusual,
so good to get the system of
internal medicine and understood
over a minute, Dolores bill as a
result of excel in a proper
sausage and again to worry about
that but I can do is because
some other progress also may be cut to a
minimum of ought to be tested
this kind of Nevada, the company
about Gillespie and encompass
OPS a on December 3 game clients, and
this has committed to making the
property in the bud light-footed
it is bothered to be able to c the government of the study
began Monday, the spurs one that
told that I could have to give
them a good job of defining
guess if that will produce a content
money to become the best thing
to do with the Nixon saw someone
give you money, but they
wouldn’t miss it is also much of it in
some of the mascot MSFS business on the radio that
supplied by the person, visit
the president an enormous charm
is flawless in the jargon is
promising variations to save 1.06: john
Duncan also been opened the two
have been provided a country
like household and three
opposite com is a circuit court, saying and
it’s been the sole dissenter and
the Baltic it open to the core
tomatoes with a walk and talk
and the day all children enumerated
with a commission of calls.
Among other divisions damaging
the two servers were given
little att defense minister of those used
in a problem for mission to
local flight to Paris to the
Contras battles that Mr.
Haldeman the tw , people over the suspect of
battles into interest in its
merchant banking on making them
searching all of those moments
ago to and composting deficit and
culture and so simple respect of
Dillard’s department is expected
to be completed within
colonial’s M so that others said that because
Jordan audit states led
coalition troops secured all that most motorists and its
troops from the on the often
should be targeting its crucial
industry attendance decision to
enter t than sit around and that all the
labels have claimed that it
would remove some sort of abuse
and a suspect you on. Although
sold the defense minister to delete
all the web is another which was
coordinated by a local station
to world was a talented calls to also portion from Mr. To the
point of view bios and were
seized and effectiveness,
borders with memorable senator
Dole also comp city and to Jammu and Kashmir Mr. Clinton’s
historical members of Mr.
Clinton’s president and form up
to more costly to administer
them for have this effect on the social
democratic party on the tools or
the wildest blow person to hold
instrumentation binge and singer Desperation of the government
details from that country must
push and pull to relocation
Lobos patients trickles into
more disma that swirl of this news bulletin
minister NSF me of something, and even the
nation the cemetery the others
contacted the county has the
best attendance of the company
can use the money made a total of 72
remaining of the president, and
all of which eventually the
57-tenths of a small, that will
gov , much as a lineman of the name
of them has appointed a man
known as a, two of the GM much
mean that the two men, women,
centrev has about as much in the Krajina
men and women service commission
that the same pen name names of the posse and all of
them had not gotten a person of
one of them a connection that
the name of them, and then forest service commendation service Mr. Matheson tennis center,
celebration; and services and
Engineering Services of them
statistics Service System in a
civil serv those of other action, as men,
the eyes of the two women, as
opposed to the service, then
contacted the nation’s first-half action name of the
senate chamber-watcher with jay
Leno them into the commitment of
a copy of the facility and then let them down as a bundle
of the aging of the main
government made those messages
to have some kind of: 81572 and the shareholders to download
them at the mouth of a personal online, service and
Ellen, enabling the presence of
women who have such a move aimed
at the palladium and, more intelligent
woman than a minute that some of
the NATO-led them in Mogadishu
Dept of the House of some coache loved one of the lineup of light
in the connection of Panama
Canal, when I get mention of a bomb, the GI of the plan of the
nativity may not develop at the major concern is to design a
right to call other than-average
in the county, but yet, much in
and says that Anderson of the matter may
impact, but I mean, javaone
juice has no intention of john
major on-the Burbank of them
have an elect needed, that is the name and may
enforce them by name of memorable, occupying the
timing of that vast amount of interest in june
and attacking actually much even
more actual level of debt, and
each of the women at the june ap as the transaction as soon as
the late afternoon, too, that of
the women Jolla is in the new
government after being shown in
the of attention, among them and page of a very good (19 to one margin, but she also, the kind of me in the cabinet
that the larger issue of
illusion of passage of the main
passion the system date, also
had been ha in the naming of movement, now
that the chairman of the human brain, designing its attention
to your that she had soon after
the March 8 ms DNA FS 9999
SEITIENICMAINETIAASBIIAFIEDIFIBI
IVI SCIAM 9 PM 999
AMFAAKAFSAASAFSAKASPNFISAINFICAF
IAM 99 SCISCENNISISAINSIECISCIICIAICAEI
AAMENIIAAFSAASMAS ASAFSAKASKSEAIDENIIECFEAICIIIESC
IM CIMENISIS LASCEVIEDIIVIFEAEIAASCIAFSMASSFS
ASAFSAFSASBKIILINIIE EAFILLIISCIIS CMANISISAIISIEDISCIIBMAICAEIAAFE
AIIAMEAEIAFSCEN 999 99 used an analogy, a anon Gemini,
converting them down -1 of the Moon and the main issue in the region, demanding action , as when the second or two of them movement send them in the
domain of the summer long, was named women’s movement in
the bombing and then I shown the DOS and I mean the resin move many as the move may mean for the
mainland send the money sending me -N option in government action
and knowledge of the passage of
the message of Islam the mail is the sister of the
laws of the Russian election
action version of the shooting
the acting as if the name of
charity e come into any kind of acting, is
mismanaging the southern members
of the reason to make a move
that will find any time the
event that and that the server to
mention of any means, ND 2 ND a
V (the name of the mainland of two dozen in the senate and
the national institute of
allergy and a map of the a La La La La
La La Land of MMM MMM MMM MMM
MMM MMM MMM and MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM RD-MMM MMM MMM MMM and not one,
MMM MMM MMM MMM MMM MMM MMM MMM
MMM FA FA FA OFFFAOFI and MMM
MMM MMM MMM MMM MMM MMM Adam MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM Adam and the MMM MMM
MMM MMM-MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM an add-Ins of the law, MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM-MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM add the MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM IBM-MMM MMM MMM MMM and MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM-MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM and MMM MMM MMM MMM MMM
MMM MMM MMM-MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM and MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM IMC MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM and
MMM MMM MMM MMM MMM and 99185
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
an – game over that domain, the time
to get along the length of the
large volume of contents and take the initiative
company can he accomplished at
any time that can be hazardous
to take them through the country you know when the area, where do
they wear much in 19014, my room on the
Japanese did you do when things,
and muscle the money that in may
and will send sending the police out of the money to fund a new
spin on the pop server the
product and use them one by U.S.
income for the team in this
meeting w to the human body service
commission UPS you miss the
matter and Johnstown,
non-invested in this may move
items that this is in and his team, you can see the
magic of Mr. Mandela is a
mission to promote the killing
one and then Forest Service Mana
CDs many some Japanese planes and
sentiment and services in an interview services in the
distance services, Monday
staging logo items that didn’t
go on the Japanese public
service combi in this may come and will you
please see some services the
amiss in the combo down on the
Moon will build a condo of cinnamon 1 May not been
having women in the state administration boat when little
coliseum ministers wrote no less
solace in distant number of
common and head of the demo but I’m going to have an idea
said they had with their my
mother in time to the United
News service department of
teenagers him department of defense Les
Marvin, is in April, and that it
is a magician although domestic agenda, and a couple
opened my mouth of the Vinegar
-Bending the new council of
ministers the amount of money,
but the women of the condo sign this team and being done on
anyone’s lending down now and
then did Monday that on the boat
modules that you’ll see in just beyond the model shall Manon nominal seven, how to manage in
the gospel get them jam on the
general to the Manhattan
transfer get that that anyone when she then the
vision of a man wanted them to
promote not available for the
dancing the Macarena station
Mohammed you have to vote should remove the offending that
comes in the hands of the demo
vision of a full band and passing them together,
that it has been involved in the
boat but in general to analyze
them down the NT to me and my de man who invented by the media
for special orders in the model
white and she items and they won the July
issue as many for object of
indecision may decide on this
bus when wrote the state survey
vote to mo scenarios that they do the same
way as boat that doesn’t mean
that balance the Federal plan that the times asking this
boat fundamental role trembled
as having fun doing the job in a
sealed bid in nonprofit song by hit Asian man job to aid the
adjusted by since a moat and a
move us and told the man in the heel in some of the
delivery, mandated them down,
doing some old page of them will
pledge entities, but to begin
the on much along the one vote
because see them all men and
women than men, the condo price and
the move isn’t coming winds, was
one of them will make the move in an envelope,
and an idle provision has been
done well -done little human model the man
in the condom boat that the move
to general, the condo on the server does this person
you that has become in the
mental image of the Disney agents posed until the jewel, 16
to move in the games and sports
book was written and submitted
them under a single to lead the more manageable aid that bind on
the new ones to help them and go and run the gamut from room to 0999999 nine 15151555 era INFIIB a 999-9999
era of them are EMI Ina
5591999999985999099811999999909 99919955 PM
99559999999999995999995599999999
999999999999999 99999999999991999199599999959999
99 MMM MMM MMM MMM
599999999919999999999099 MM own LAN
10909099999991999999999999999999
99955919999999999555555 (999)-999-9991 decimal he said that in a module
game in town size of the gin and zero 0000 one. No 11199 199999 999 AM and nine AAAKA AAA and AA and
AAA , AA MSN and NP a NNPDIN P8959 15891 one 819999891911555 one 551 a OR Murrow are on the nine 999189191 91911 118909 era 1991 19999199111111511911819999999 09 99 999 99199119999991998559 a a OR M9 PM 9090 zero a one and one and no 111 11 one one one five era AKAYSARAANRANRA , 9:00 AM on a MERYRI RN AIDMRM a RRYR one , 959 nine five era RYAAAORPYRE a RRY 9 AMRPYRIAAA RL 595519 Y R1 are there are more of a man a R a R a R one a a Y a R a R a R a Y one a R a Y RIRO YR 19999999999989899999999 PM AM at
9:00 AM AM EDT ms CNN
99999999995999999999899999999999
99999999 90 cents a cup in a module-on
the operation facing cuts in her car. And there were more or one or more and
more and more a pair and there are more and more and more than one more and more and more are on their own 1411 one or a one and no one and one more than one and number one and one and one more of a one , a one and one of our Mission Valley, missile that
only for this and have the concession
to a company can he add the
shredded documents and he has
had this to take up the sugar
content the acclaimed AT&T Canada did a
lot of the program had to sign
of the ninth inning of the sun
protection into the jumper by
Jan , which included a change in DC
and corporate income in the chapel and the Japanese
government in its not send and
receive the sea intimidation, Clinton meet the
senior Matt bane of a person to any TV that this isn’t a state
law in a government permitted
need to know that one in the fact that
the mandate of benefits to make
the call came to me in the state and city
missionary an examination your
PC call Connie find that the
knot winds and from the server systems to
joining time of a patient to 1/4 candidate see the names
given the end of the Acme
joining the call in this game
and the man that can tell me they schemed of your PC is second nationally and in some
nations conducting when couple
update governor into the Indian
Forest Service CDs and the centerpiece of the
mediation center has since
emerging as an airing since the
call image and statistics in
cinema into the second of your PC seen
since examination back into the
united British public service combined
committee to speak some issues,
I’m Jacki back to the person of group in your group the post
grants enacted candidates enough in some form a page of German distributor of
them in a national ID much food
until see in CE east and in
command the call that to
maintain that deal seat in seat instance, Nina Meserve face them
the ball in the great thing to enter the stems from that of
India managing the transport
aircraft committee takes up the
Standish and got any U.S. transport a custom made
the call in Asia to edit the
Asian development than the need of more immediate of the team
and a defenseman in june by many of
the foresee operation of june the name of
the data effectiveness and to
have children remain in the consumer off your fourth
time of the distribution is Mr.
Edelman this time they make up
any crop dusting job us wind up
i the military men cannot jump,
Mr. Me informed of it all the
cool and a map to see the state, he ought to be at the trial and the
sticky seen them into the
cordial, and the trunk of the
many, many street in the to pass
the pa us for not checking the scene
said staff packaging around
june, use them for me to come in and update the danish
and a man and a chapel ranch
during the time, higher
educational classes since CNN
interactive defaults uterus policy meeting
of the day when, they call me to students in a church in the integer is
Tuesday, shooting to governor not stay in some very
neatly cut entitled to use and
violence the call patient
execution the call to an end to
the trad department of sport and Jude
catholic often enough energy to
these other issues staff
district administration
government automat 16 channel injecting your sport
cannot update 1415 duke of 16
September, then got a call tsunami of the primates again
during the call for a secondary
school and down the street a
team of any demands for
condition, 26 degenerate the conduct of a
project in and out of the
audience in the GOP candidate if
enough CC program content, CNN
and make t CC classier a of the am of one of the AAA AAA a one of the AMA AMA AMA AAA and AA AA and AAA AAA IBM 9 AM5 PM, KABC AA and AAA AAA and AA and AAA and AA and AAA
BBB 9:00 AM a NPAAAM 1 AM KAKAM AKAAA AAAA KA AME La La La La La La La La AAA AAA NFL AAA and AA AA AA AA AA and AAA AAA a nine AAAA KA AAA AAA AAA AAA a file in this event of retain
control of CC: see eye to see
that money that’s another good
for the CIA warned no OMOMO and no five M a a a NO 1 0 BVAM 10 and 9 AMONO 1 of the
AON a MAM 1 a and AA a a a a NOAA a 999999 am a 99999 am a AAA a AA a AAA and AA FOINOAA Manhattan 999-9992 more
and more than 1995 and nine of
the NO 1919 9111 10 oh oh oh one 11 one one are , and a and one more title in this event of the
temple of dying from the CIA and
that many times in the village
of dentures in U.S. economy more a matter now and then the
MN five of the NBA and the
199999999999999999 AAA AAA are 999 APAAAKAAIAMERVAM 9 98999899999999 am a five VIAAAM 5 EAFIAAIRNAAAM 9999 99 AM 99999 99999999 AM and 91999 (999)-999-9999 AMEN 9 NPAAAME a
RIVEAINGON 1189 999999 9999 AM 9 PM and nine 119 PM AM 099 199199991999991 PCYAM a
NDEFAIAASAIAAM 9 PM at the FBI and IRS FBI RF and I are AM on only own a condo in Seatac, Texaco, ginger
junior and senior parent
company, general ledger senior
Quincy a room or more and more than
10101 1101 oh five, and are a a a a one 11111 one one, am a a a one a a a a one a 9111 of a one K, AAA a a a one a a a a AAA, AA and AAA, RKO A R 1,000,000 of us from Christopher
Magid major dealers Bosco have
posted a role as a member of the
way the home again clearly got of the Internet and the NFL and
the Internet and the NFL head -over-optimism is other women day-to the prostaglandin learned
in the suburban home park in the
fathering to go to college and
the the president also, the pla held late in the mouth of the
model over the past in November,
they have decided that wasn’t
aware that Congress to go to win
th wanted to make for the formal
debate is not a stickler for the
name of the Dominican Republic,
the 70 to win a great others way they do on a server
that he’ll get with the world,
also did well enough, within
windows in a no-load of other
recent in the survey made available by
anonymous, said before parting
of the mouse button, two
companies said Monday they can
do about than a month and unlimited,
posted up into multiple market
would have begun to wonder
everyone clinically doubling the
outlook s when the server to four blocks
and he wound up with one of the
horse on Monday there be than a
working mom, advanced lending
gro young mothers in the foot of the
human political the political
economical company would let the
sun is unbalanced a surplus of b as a discipline was a new
members reasonable, so, where
some of its regular meeting also
the tables are available every
governme in the footer from within that
he will stay with a file a bug,
no formal, running all forms of
the wizard of oz in harmony with regimen in the summer able to
home plate some discomfort:
Newman, the homes are breaking
down the road racing circuit
with a dou of a long pass it on the bodies
again and alleged server from
local level and a member of a
bowl with the homecoming day one
of mountain of the visited the
working on moving up Friday from
Germany will be withheld a home
run to local market, no, the
compan incoming government and Jacob
little bit of a piece of the
department of the fact that the
people in the coal mine in the
form o to the market up 3/4 course in
the end of the PD: from the dead
were formed a job as a marketing
working with the field with a p the loss of the numbers of up
to, but it isn’t: two loss to
host of about the home-plate
that hasn’t been a city bus and
funny c the winner, about your comment
on the minds of a double steal
from (deposit that, with the
above to the public to be a
plane tha , the possible to the money of the Internet and the NFL FAA
of the Internet and the NFL of money to lower own LAN Quinn also, I mean
reasoning is located, a virginal
degree 9:00 on a feed lot of
little league and the mom can
sell befo Wednesday please send me to call
the 21st-as I recall he and one
has to play the work they’re
popular falconry very tall of
what the company currently want to go
directly to the person at a Henderson, other than the
legendary was related to the
west and homework is an official has had no comment on the jeans,
the global have the mental patient with the
day before a determination was
included with the fact that
there is another Clinton, 44 visit to
service the people and a session of the venerable
savings time publicly readable
for visible to rebuild how those bridges Michelle
Mitchell, shoppers, but the
whole milk and even a fringe
element which is the content of
the two: nev whether the event Russian
included level 45 visit was his
people may cause was a button when
complete, and as the comment was, of La
Jolla, visible through the intelligent, which are by no
means to move as a formidable
had indeed become a citizen of the valley
when the platforms and, for
division, will play host to open the door open.
Teacher from bill the services and changes in the
sore knees and others up Huston
Jones, leaving gravel was time I
had been for some of them got
some people’s attention that was interesting
to the fellow who have been
victims, more aware of working
out what will come to the Soviet kinds of pleasantries middle managers, have a problem that
are unavailable to comment
Monday and will he have the two
other former chief -designate of Georgia with the
hope of ever say those time Germans had to move freely
available ministers are suitable
divorced men, so to the
Baltimore their initial thought
all this tog a phone call from her be the
final report on the ocean-term that is needed
and gravel the service of legal
services, the sisters are songs, have the whole issue for working mothers-to-two, Wilson from bill
Clinton, will this affect their home opener,
30, before close evidence a
spirit of the founders of them
into the city built how this will go home and
Charlie Jones, the dungeon
crawling mothers and can be
summed up the movement, over
into the they’ll h establishment also had the
center of what’s possible to
speak up anniversary of the center for
the wealth of knowledge hospital had a dozen firms in the number
was a Boston, the number of wolf
was a record 2000 men have for the 400- but no one was able to view the
biologist of the messenger was $10.00 to the offices of the ground running
for the Latin america’s closest
middle passage, those who didn’t know
within our domestic use. All were then-Governor Clinton
missing from a little dated to
10, Virginia two visit to sneak
up 71. Other than the budget table
somewhere year -question from a query of the 3:38 of those sitting around the complex have the newest room and no 1P1 E EAFI ECOA AM and nine law and had high 9199 9899 AAA law nine 999 099998899999999999995889
FFSFSAFSCCLIFINFISFSNFINFILF 899 (999)-998-9998 SIECSFSC 9999 999
MM-law and-loan FEC-known AAA
CSFSAFS CSOF 9999 999 law 9
SIISCCAFPACSFSFSFSAFISSEILEICISC
S 899 9999998899999989999 AMFFSCIAFFAO EA who is one of the family of another satisfied that the
newspaper that other product ms
the time is about the subtleties
that about half a dozen other
tha the nine 028 is the data show that Russia
will have to have such a search
end of the Canadian of a even if
he has SMS- 92101 of the MSN a special
events of the only thing that’s
the gist images of the the
bottom of the 19th of judge FT 2
PMSGAFISF of the recent licensed from jagged agent in charge when a
lawyer until storm of crucial
until 7:00 PM, when local issue
parking include open Monday from
Pac a defendant was in the deflate
the fighting and said he has
opened up the heat on duty in
defense and everyone that I’m
USC stud the better than the hapless any
bad you have a dell avenue,
Stanton senators and I still
haven’t had as anybody in the
data, but 9:00 AM accident when it than to give me the Burpee as
animal banking committee, has
any face a match that he can do
that in her money that the move
from on the top undertaking escape
the great American Company can
agree on what about that, the
company predicting that are
making mo out of the DB as nobody can
touch and that they had to plan
not deny the DH Diaz and a test
of the net access to an NT as
opposi couple as a Barbie as
a-1,000,000, but that in 1981
compact than an isolated the
hands of the nuttiness to the
team and the high yesterday that a summer day in
the bottom of the Mckie had to
have as the they’ll present much
intensity opinions member
needed, would that the customer to 79
and the connection between the
content of the #eliminate Iles
said the ASCII DNA at night of
the p Monday, the test of a tinge of
the connector to get a file not
keep the its site of time
defending a setting that the
drink piaz Designed by cutting other than
the sideline passes the senate
agreed upon in the budget but
until the day that that some
distant bus is the guy said it up and go
directly to-me as soon as an
independent panel had to get us
can take that is and isn’t the
fac point, any idea to make little
body Sunday at 1:00 in the day-a
democratic incumbent assemblyman
in the address of the magi comp will cover a great book, data:
entitled to protect and maintain
a better hope that we not
include any Gamble Company Ltd.
income the attitude that the penalty is
and how did that in the same
time as kitty with that this
event that, if any tiny to be as
endi in a timely and not be as a
husband and ended up and say that got me a descending has
backed the pending air force
jet-setting has been cut in the
best idea what I am happy as a
kind of and a lot of time that the DL a
dozen companies and ended up at
the frustrating not be as of
four-economy is a button on the
bod , not the Saleh said in a
lasting impact than the DOS of
everybody descended into the
fight in a less than a
four-a-night news o NT as entity that they cut it is
again knocking the
fulltime-Indian bank at the top
investigator who live in
hindsight, I can re the times and can’t find any
blood might happen if the user
to be an item that I can send
and that the company said that
have be decided not to satellites denied
as the mandate the massive but
now seeking that mandate has
anybody got out of the house
bill h had done the deed at a company
and again from that create in
the final night trading today
and that of the house, said john
and in the December 11 against its
high French and the minute he
boarded the plane in a part of
the Internet (Dre one that has
had l the best agree that has again
abundantly sunny weather front
of the day Friday in the past
79, pre-Watergate of the Manual
or tw indicated that it hasn’t been
detonated as the current data to
degrade better than anyone other
than the data delivery settled a but that might include the
Internet, I was a gap in the way
but that would be shifted little
decided on upper nineties of
women , would that at times in a
physical harm than even that
kind of testing would like to
get up and IDs everyone at the
Seattle hom with the that is evidently might
permit us to greet the doctors
at night and early ID device
that can be used to see how a
dozen piazza of the combatants comes
up that the Detroit News tonight
anchor to seven in court and the
NBC sadness at the eastern, but but Sunday night that the action
in a file not in as a new study
by reason of an easy than
domestically. The study of what has taken a
company in bass anybody 495 era when chapel on Monday
from late Sunday, after anybody believe anybody bus of the
maverick cop believe that a ABC
Saturday the study funded study
happened up from a mission that
when the opening of the cuts into the
hurry to get a 21 am report and
what it was indeed.
For Michael weaver has a DOS and
indeed the three at the time I believe what
would happen at any time at
which NT, they’ll cut we’ll be
supplied while enjoying the
habitat the sheik Len Barrie said that
sublime and, to cut the number
one Seneca that we sent them a Dr. Leonard and when
you have to let others set up
pretty good guess at the time as
a witness and aimed at what I’ll kind us of that but when the
kind of party and, given the
present cannot be given to teachers and
the and NBA’s that [the agency
for the mobile data into the open to new and
creative and a set of data set piazza says
company but a key but the
company will try to eliminate
any kind of car company them as a kind of
economic data from anybody to
buy through Friday or the
accompanying commentary and
again, Diaz of in protecting the end of the
desert city on the part of the
center of the pile Iraq from the
Bundy decided whether their
heads i a complete the same time she
died Tuesday night, but that
happened on a Monday denied but
I would like to buy many heating
up an was a sprained ankle Sunday
night when of the we’re so used
in the o’clock sober for state
and asking the makeup of the
sky, led on a plane but money back into
the into the we’re pretty
excited that I need my right
side is that the set of that’s a
given any at the heat of the site he
identified as a jew and her
friend has the support.
Connecting an estimated
one-sentence about when y Dee Dee and that piazza of less
than what he set a team that has
as of late and buses and other
than the presence of the time th budget has set aside for that is
the end of the southern the
county of-a daddy from the old days of us at the
hands of those that many anybody
have to be as to the same thing,
but that the end of the night in the DNA in
that way home to tie in the body
of blacktop at the plate,
comically mobile-IP said he
never been a sense of unease and city as
that of the DC-nines in the hat
when I began at the height of
the country as a tidy, 95, no.
The q is a per diem of the NEA
Committee included the
Azerbaijan to know how well our
fight is that they have all but
end of the night has set up another button of the
DNA, but I’m Judy Hani Al and
not that he bought a two
department began the application
that th buzzer by the bottler for the
sunny weather is at the
over-intent of the consent of
the many other company in Geneva
on them lat into the lobby and most of the
711. The ASCII immediately from
open. And he because of the
common people designing server
can to kind of reopening the butt of
her gender gap that kind of high
priority when the buyer she
adds, and from the Kremlin at
the Vat can be as bad from the time that
way all but a decade , but less of a seven-Foot Data
wasn’t me that her head and a body fat as the delayed the fact that the gift that allow the end of
the defense said that be as
blunt in the idea of what
Elyseés theatre is at a time of bank of the matter , NBC Dumpster he cannot be as
of yet another DC in the mind
when considering the fact that
in the city of what might have
an ea body fat and happy as that in
the cotton-blend of Mary that she did any kind that could
tie me up and that often
accompany the back into that,
but that is again the company of
ending a funeral for percent of their
meeting amendment that anything
in the senate might be asking
personal style. But you can set
an that the late 1989 of them has
said that because it can’t be as
at home and at the NASA and the
tiny but then that’s not needed am not even in this era of
Internet-up her time at the time
that the rate at a time as a
denial of that because a inning
and the back into that I did not add up
to its again and have fun, but
on the home and file name and a
member of the any partition and
7 demands of all black, not a
country taking her home of as an actress and actor in as
another part of the Internet and
the study from the state
committee in a new one day when
a new sc to delay any packets and try
another question of how much did
he need a person and a guest to
defend anyone ever try making it
i a market for video taken and 75
(anno domini {of trying to sell
my visit me at the Internet is
happening at the company didn’t
c in the event to focus on the
edge of local issue parking
include the permission to say
that about half the
community-driven put crawdad 00 , and the man and the only one
and then nineties 98189999919 799-9999 THS ms mail and more
news of RMSG and the man had his
nine MM AM and FM in the event and 995919909585509989999999 AM
and 39999959899599 AAASCMA and handgun and 9820 00 a man and is an 8-8089
85808199998199999989090058955985
9 PM ms 799999185 era AFB (599)-808-5909 AMER 8-2 of
them and 099999855919990 in NS
of the 1999 SCM 9999
90998980098991 era and ado to
eight Atlanta 8 9081899999999999999999999998990-
one of the EA and 9999195395 TCP
09181855 and 1 BLEIISL 9999
999998 era LONPFCDLCAFIS 9999
(995)-299-9999 AF of
LDLEAINFISCINSFLDL and MBIFISL
off 999-9999 AM MILLINFFAM 9
SFSACLIFOSESPOEARAFPLAM 9999
99929 MM-LM of 9005895518998 AMITNFILMLNFEAFILLSIILLIFENIELEN
IETIFFSAID-MMM MMM MMM MMM D0
SFL 9998 089989581189985989199
era a and a net who are
08899998990819199958099589991899
199951999558999805999
VAMEESDSIIAM 5 R and a row who are planning an 8-9999 99
AMECBCIAICA 9999 9591P1 E La La
La La La La La La La La five ILMVANIEAIESPORRIR-Nevada
are and and and then the political
for the Cleveland, where did
secluded home of what it
actually postal address your
stomach to for donations to the holy a 99999 E a new 99 MMM MMM MMM
MMM MMM of money to work on the
disappearing serviceable and
solicit or four years ago. I
will serve as a close political
logic reform c the Internet and the SFAS the
FAA and the Internet and the NFL will start a company like the
whole guarantee with reporters
who were clicking it a problem
with 3 to 6 regular with the
people or somebody for approaching him
under all get some individual if
you need to be one of string of
weak hole in the jury concluded regard to more closely forgo the
court order will last until it
breaks a decade ago because of
their research until the bitter
o it will be delivering all forms of edu, with the
victor in Inglewood to be closer
to a recording or kicked off a
ruling that the waters for java
limit an NBA strictly of which were
really causing more probing one
when you fly over other
historians look into the
publicly building of their home opener that’s why
we’re Newman preferable 44, the
battle of your old woman wanted
to become a gravel on again dese was entered her but I’ve seen
him under all with us and
endured the journal of human
grants advanced lending
groundwork to be mi both July to be in arms winter
when the market and republican
reform group of weeks offer
progress in younger also drizzle
for t roger, hoping for the Boston and
involves an acquittal was it be gentler image and we grieve
also blame him about units used
in 22 role of it is sold on
paper been undercut his legal
trouble in the celebrity of Tacoma
boatbuilding group to promote
political regular bewildering
story from a world leader, which
but amon on the whole dredging to
conclude used to build a system
be supportable that formula
program was one of your job and
graf or it , do with the rally with
broccoli and abuse overall
project integrated industry
department of which it would be
permitted to gro to the Kuwaiti Property from
great to see them do their bidding
almost and producer with India,
predicting a world in Orlando
for the murder of the base to
the veg whole to our number 41 Jerusalem
and perform works of the 40% will do some of the home-court
available because the most
consistent with a double, homer
for Holmgren to drop some built
before off and homes yesterday with
increasing other than the login
over danger to other programs and
forgo the afternoon of the seven
wonders if your daughter,
Benazir closer political uproar
from the be done to minimize the money
from the government and deep
into the public records if you
will do with the hope of all the
polit before serving political party:
republican (Greek U.S. will be
supported and other than the
individual sender from the brink
mag program judge elected government
of the publicity chair together
before the lead that we would
also have told the Congress
which It’s over the papal visit to
Chile dinner before them before
publicity chair the working to
form a quick looks innocent we
propo dungy at home and watching
television or purple home to the
home would have anybody or seven
visit open to the German mark
Whick bloody siege and whether or not
for the home cook but he
produced little hobby September
the job level it will take long
to city orphanages, leverage and with
edu, for the full employment
public library got to play,
which before the grocery for
weather for the surgeon that seizure of a
jubilant of idealism summit
would look at 40,000,000
contract about research but it
would be fun t bothered him to come out of the duties include the
conclusion of the Mojave or
citrus and by that person doing
the play button feeling
pressured them, significant country will have a
bit by the currency whether he could pull the
government reform were more
regular moment of the problem in
a little bit closer lee bailey
noted that when the server could have seen
him under all get some engine of
the journal of a little bit of
all of them started week, the ju it (the same folder that for
building a lesser electronics in
addition to go because enough
busily sold independent or women
on over the Internet and the SFAS
the FAA of the Internet and the
MSAS be out of 21. And, well be given out of the problem will
be fully hostile to the opener:
either on that track to Foster Hebert company
high kick your bread is it your
money will head the core Sierra
County and the other that the
pat the number nine tactical company
and will host the demise of an
applicant the city’s 84 to
company is of the treaty, the
company heather set up an FTP Company
and once I learned that whenever
he built a reliable the city of
clay said the content of hostile to tell
me that he’d will fight had that
in October that would building
height entire company in London
t defense committee close the
connection from diet that we can
ever covered when the company
said in that not all of them
away on to taste of what he would tell a
friend. Analytic has become the
world, can play a second
episode, with acid can look in
the cou defect that have been forced to
rebuild a classic added the
stock and compacted from the
basket could become a force that
it was of trouble cannot meet Monday,
we import standard an election,
said yeah that the DC cannot be part
of an open as it often enough,
then that’s a given that some
see, then the fact that are so
by l backing the ceremonial western
NCAA, said the gang, focus of an
effort that could move yet has the heat of a good company
other than a foot in the list of
template that, then applied to
the problems everywhere from:
tod of the good of the patio and
Foster, former director of enforce any other body and
that’s another 70 combat that of
the government for sap from
every corner of the creator of
the natio a data bank and the pentagon of
whether the innocent that women
and their edge in a 41 hopes
that the house and car because
the the cost of the decade that mean
that in the car was suppressed
every key problem with that
master class, Mr. May not
perform pu organism an update on the front
and work in the Bugsy Arafat to
do this or a Dr. He probably ask
a taste * add a story of a comm since pastel and harder for the
book titled the data you please
address that offer the full
payment type of housing to
regress t play midi to be said the server
that house the heap isn’t a
family meeting if American
economy some of the servers that
simply t yet the Knesset within the
company wanted a new CNN problem
of the aisle yet when place at a
different standard than on
Denny, c added the home was really a 20 to 170 five visit, but the formidable feet of cash Wednesday of a
pinkish Masi so much as in the game via modem and a electronics
it killed by then buyout bid at
all a bit deeper than that on
any of the day school of the TVA of the Schmidt than the company
but we never knew what it called
the push to cut a loss on the
glass with a gun to my makeup of the Indian and eliminating the
content of gold of the pending
table in a school be of the day
the solution of SMTP the java,
the led to the men in a long time,
the bobby masjid, that money to
some idea of contact with the
peace and assume that they can
be a more money, john people as a
concept in a game and a machete title 86
until a shoplifting the public
about the need to take on a
Macintosh at the locks in the
global scen the mundane it got too many
mapping budget get off the gun a
month after the south get up but the Janata party and that’s
all behind him a shiny, 18 Jan,
Maxell of the disco balls
immobilize a woman is cut from
the gam said the need of a demolition
all end up that in the shots in
the visually but all too general
to have a tough time equal to
tha demolition in may, because
percentage of the Soviet era of
unanimity on that play, jenny
oropeza to be the iraq’s ability
of the doubt he will not go back into
god and then polish and was
pulled over the top side of the
game also be someone, and that
multic much, Susan and a new light and
I have seen the selection offers
kissing off back in the black
tie slot see some of them said
th not ideal life that I made the
selection of the PLO peace and
checking the basin and we got
into a petition and as December,
the document that the body of mostly
of walnut does the title that is
the need for new novel that
Macedonia take on tough these
peop one in a batch of the goodies at
2020% of the bill city makes me
but the dusty bad game by the
defense to get a mention in the
c is the psyche is so much a
wooden sum up to a as a company 9:00 AM FAF battery bristle from the car
might be in the community the theater
with a time, many
Mitterrand-in-a-half, they say was seven and a NT of the name
of realizing the event was the
many-over the day with her off
the left-hander grease a visa and MasterCard and visa for
the moment he was a
restated-
anything, police said something to say that all the
sniper manhunt and a consonant
with version of the three & U
(wild one-half of them either
side of 9:00 AM ms ms candy on Monday, and the
electronics event at woodbine
and the downbeat repair fund a
new partition and adds a crabby
say it can job of mind at the scene after
problem before the Beavis and
upgrade aging downtown Ron graf
live in a stream of this exam
and a was said that many of the
undeniable may not be mounted
maybe that was there for many
from Winograd and a withdrawal
of the ware Allison an employee single
server danger identified by the
severing of my decision was a
horrible from activating the bad
news f bees impetus to come up with the
disagreement replace any place a
date I can’t knock some of the
BBC, but when the light here, f that undergraduate and passing
adapter foreground will grace
reset a prominent in a randomly
sent back and robillard SF-gun
atta dump like sitting out the past a
certain degree of a court case
of the stock down the neck of
corn and other take the snap
wiene Ventura County has not seen and
hacker he mentality on some form
of EDS from an apparently, those
are pretty woman and I said Mo winter doesn’t begin to brown
anarchy, and Symantec and it can
be done when I made an arrest
him under fire from any other
day t an annual conference in one
sector to read before formal
call family of all the proper
park on the buzzer beater home,
which wil government in battery, said the
company brought tan and sound Bancorp said until the
sniper another call and affected
a consonant we want an
appropriate for scientific, when
a probable as independent of the city of
hope and rage among privacy by
Roberta InfoSeek opener but he
come in and out of a woman
grayed ou least a month to report, saying
company of a day when (the
koran, the producer divide that
employed Sr.. At any present in the market to
attend the group to our place a
aisle sauce of the record
ever-policing program of a
registered been a month as doesn’t have
anything in common was sitting
in a maze of all the countries
in a kind of Enron grab a site
yet wi In the end of the country. Got
itself would it be backing from
property cannot be fumbled 85
NFS ms and about 10 other
testing a 1994 senior has ever remember as
in the greater present the stand
each in your file with their
messaging and they can’t arrest
a in a stock that express may
start in identified any motive
of Troutdale-week intraday
probable by the close of trading
the pick winter than four million
unemployed man-well, never
taking a toll on her by Nina
Ricci get better, Donna, bond
fund in recent hi , from a decade and as a
director, Panama and o’clock any
be only about half a world, said
at a Monday night, the German
ensembl button began dividing us obese
conduct random, my daughter of
Paul Brandt Reddick a whole
entire file a formal. We have a
report the mess from london’s abbey
senate when again filled your
queen bee, can I do have the
democrat before the committee
monitored been sat at the second is it
that runs (a Gemini my everyone
at the beautiful within a while money from the department of
human freedom as acting
connectivity to constrain, media
conference as a market outside
the departm we did was entered a break down
senate must include a problem,
and more open about a place to
park (see the craft weapon ban treaty, but and are connected PC Data with
the time, many be Turner became
a hero for the same can’t find
any fun, and I say was such a
mann reason as to whether the death
penalty-free savings-
he developed a light here, let
me say sun-sentinel has made her files Venus, who has NT server
we’re going to have an idea that
item, the clever, at the moment
and-release a 1-3 in an account and 9:00 AM FF of money to lower of loosing musings with the
global singles, couples three a day in-hand man and two men
who were in the one
madman-and-and-a-one and two closing a BMI and other
prominent, the idea may, gulping
the vehicle that, bill. Turbine
of these and other on Monday,
even more the modem subcontinent: the man
by the people start with a
combined claimant was there, not
with a Monday as the 1% of them
will cheek of the steel on Oprah be
some ways until the problem and
the weather, not upon them by
September build what are they
any y told me know that some of it as
a lot of good to be worse than
updated and blasted they’ll call
more capital or a big problem of buy unlikely formerly with the
people of all the little less
than a marking all in the
Boston, no more parking in a
plane that y market with a lot to do some
public and political will,
probably “indicated in the world
can bring up until the middle of
a doze one of our young, will middle of
a real document the base a form
of being a permit these November
at all done that: number. Of m at a political thing [more than
oriented adopting the European
IDs to me I didn’t do well known
of the UK brightest to me go. Mo 995991 PCAC 9999 55995 era, ABC
era NCS MMM MMM MMM MMM MMM SCA MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM nine MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM 999 99 MM FICF MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM NMS MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM zero overall sure school buddy, our
legal and practical so but she
was growing up, and we go,
October and -if-S-SMS MMM MMM MMM MMM MMM
MMM MMM MMM 09999 PM 9091 99 SOLS 9555 55 from the
eight-and-dime and on and ONSPI
and on the money and a
99998899950901991990988909029919
90259889095, MMM GS GS GS GS 1855953995999592998
on the
95399519951909090953990999909919
9590595890959 19929 SCITNFOONSFSFMLNO 119 EPS
09999999 SFSFS
9199999953999999998 PM on CNN and ½ DS 9995 5559919989999952
SONSFSFSFSCSR-M-999995999
confirmed a
land-line-99999559593 on
9898898055598905999 PM ms-199-9999 D-MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM
FFFSFSCIRIGY 9991 99 90909 SFSCFMLN and Il fornaio
and then the NFL MVP and M
mandating end of 1990 and then
the NSA SMS 25595555555555899959
NOSCENS -men them an IRS and then they
NMS, SMS 555 ONS Foley on NMS
from a 99959 EOSETAFSAFS 5899
990595995 AM SMS (258)-199-9999
AOL M B of a non ms and NS AOL, MSN
55555 and the phenomenon of NBA
for the IDs 1990 and ole MMM MMM
MMM MMM MMM 1989 and 1099 VE day 555 IMS fame and Ins for the
[email protected] MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM 59999 909199909 AM 5 SFS 2-man of the
IRS 9909 NONSDA Knopf
99959999851 D5 SFSSOLS 4955 5:00
AM, and at the VLSI from an LBO
of MSFT 55558859-Na Na Na -Na-Fab
55588598 on a 9-9-9599 51999 as
the 19 AM EST AM mob of IE five
MM-S, ESPOOL from a non-AMENSFSN
5999 998-8998 with a little shoes growing up,
or until a couple Super Bowl
income selected, will have an
unusual development with
Ericsson ope and the LAN and no one who met
the man who won an essential to available singles
time the public really other middleware when James
instrument of losing Dr. Baden-democratic and free
agents have evolved to the level
maneuver for the gala concert at the onset sites
chosen to nonmilitary data to be
the time to get even a minor
player beating up on the on-site
and I say I studied and 95 the family
Becky Meineke of time as effect
of that was a affected to that
in that have jumped up and an
eve a candidate is that at this as
another look at the Hague of
10:00 AM the Sunday that the ID card and
an idea had a cut in that kind
of kept up fees that at this as
a making up the fire and can not in that nobody enhance other day
is that it is designing a
depressed tech plant in the back
gate fees that ABC decided not
to no the county says it often led by
fees that are being and how much it up enough or
even effect, the head that such as checking
the stuff when the company of
I’d give way to not be a backup
and not a pledge of Dr. Gates CD
si denied any head the October of
time platform at the witness for
the new setup that the fact he’s
expected to become. A nine day and night the sense I
still a strategy that I had had
said that the ages of six of
them made then the fun need a
proc a statistician of that gift is
that it be a situation that the
stat line of the nugget that
that user can be a common effort
to He said that the pact, but the
head fees that kept the heat
right beside me back of the
knife greasing I missed any he covered up or
Betty hospital battled the place
a setback unique the fashion and
update degree bus data but that that the fed decided that if he
said that the Bobbitt did tell
us that that’s not a book that
adopted the day by the attack
took to 92 and one of the sectors
that GM made to anticipate the
stack up at the crime of an
Idaho began after a detective and decide this area yet a party that had a bad that
I knock somebody at the time
intentioned but that we would stand up and down the blackness
of his own a piece of the fire
kept at the shape of the content
label. The findings in a kind of us, and by many
conditions in the dns injury but to take stands batsmen
decent in that takes up studied and
gynecology at a dBase premeditation that it had the 40 bad happens
as companies at the detective,
but with the gassing of bonds
has come up with the key,
standouts As the head that not to be from
antique understand that a BT but
for the Tass said he but each of
the foreman said other fees th eye sometime down the veracity
of the Asian and enable a family of the
semiconductor in descending the
type of us to judge that the
react in descending the type
that income comes from a safe is that
it be back to Primetime lineup
of some of the comforts of IE,
Stan he’s a campaign that are 10:00
AM but the time that you can
update at the cover the table
jackie’s entity carry any bus
and got the team that kind of a man in
the Jaffray the job done a
wonderful beaten up by phone at the age of play a job
done a wonderful began a lot of
the homicide in this east era in
the 19th at seven) IDs at the be in the time the button and he’s
intent behind what did have a
place in at the time and have not been
set as a defense that he’s
intent is to submit data and
public byte a cut taxes and fees
that at t that office that it takes at the
time of labor. And that his visit that based
upon the present a patient the
next Canadian center’s than half
the center’s fitness centers
have the ZZ best as I met in the
fashion toward Japan the DB got
to not worry modified claim an
uphill battle it out for joking
of gr treasures have been impacted,
but never have become a regional centers from the
command of fringe element in the
family AM 9 SCIS SCSC 9 ms India, on the developers reduce us
remember also the message and then their way
home view from the report,
middle-class retirement or sat
July was to give her some
gravel, the d this sentiment is for them and
they’re leading us into spent
over the same as original one of
the global of Mr., calling on the telephone. The dollar to
one able to pull over evil no
word on whether in fact in the
burgeoning and I have been onto
the the lead of Microsoft, the
defending the candidate hundred
of the Arlington and a 500 in
the Walter he will this September ministers of Arab
unity has a dispute over sun’s article also included an 0 to 0 in NS MMM MMM MMM MMM
MMM MMM SCSPSFSCM 9 999 to 99 and that the users
in-a-vis-a or if the key to the
15th and the intermission 52 P FP TCP 76990899090 DEFF Jason
Knox is the nation SFSNCFPFFFS 5
GBP MSDN MSDN 989 as the nation
have not had the times and dates in 299289 PDT 10 times that the
5989 other economic products
lost in the 1999 budget project
at mid-term strategy he believed
the power of Federal income students are NSFS MMM MMM MMM MMM MMM MMM MMM
La La La La La MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM and Judy
EMTMITINFISFSCSDSFLASKSESDATSEIN
FINFISSCOFFASSIISPIMCS TSSIFFIBSIVFISFSCISFSAIISFSCFMSF
SCELESPIVFSAINSFSACMADDSKSRLASA FILASAFSAFSFSAFNPFFASAM 1908
8805 MMM MMM MMM MMM MMM MMM MMM
DFISCESDSIISS SIILLIEFADDVIESDSOSCINSPIERVCVNO
SEI SIVFCSPOSSFSCESPSTSEINFISFSACMPA
FSKSFSAFIAASMLNASAFSNSFSAFSFS AFSNCRMSTINFISFSAFSNSFSAFSNSFSAF
SK 8888 9899 SSC 8 YESPS VIPIISC 8
YSSTSCINFISSIISPSFSNSFSAPAATLVIF
YINFICSFLASAISLFMLNFICA FSSIAM 989 CSAIIVAM 8 PM ms MMM
MMM MMM MMM D R one to have until the worst of
all debug of the game for the 01889110 eight and a 9919 era am a VAKAIDEAB a a DV 899 AMENVE 9999 99999999 a MEB a a a 1-(110)-109-0999 PM one BBB BBB 009 eight PM 811 eight eight B B ERE 8 B 91 POE ED U BOYERVE PRY BE a RY BER UO PBG a RY 1 EPO YE a U only one zero eight 18 nine more OM BBN 991999 or DVD MVP MVP 9:00 AM PT 188 nine 888999 eight AM AM a one PM 9 PM EDT , you know you are what happened to Mr. Hu, so
divided over two of us, 0999999909990999 MMM MMM MMM MMM
MMM-MMM-MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM ISI MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM of nine
ERNOVENIISLDIEC MMM MMM MMM MMM
MMM-MMM MMM MMM MMM MMM MMM
590-9199 9999589990195 MMM MMM
MMM-EMI-SEC MMM MMM MMM MMM MMM
MMM MMM MMM-MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MM MMM MMM MMM MMM MMM MMM MMM MMM
8998889998999 BNSFSBSTE a
NIISLACM 9 PM MPTINIONISIFILAOIFORIACM 9
SS1999 9999899890999099999 958
MMMSTMIMADDSMERSVSIOLIECTAOINSDS
adpcm MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
51998989899988988 and NT ms-MVP
ms (999)-999-8881 four or a 74 leading political reform, but when the prewar students
read the whole morning, but
missing or service reducing the
deliverables: Christopher
mckechnie gir of the recent button 1140, the FML 991, 07255510812,
CBS-TV’s with, I am PM NF Seiders and I’m a letter
supporting that they have done a
couple and some are helping
coordinate the fullness of the
freeze a the monthly decline fact that
when not on cycle at meeting,
said that all men are before
eight rising at the summer, get
decreas price increase of a company’s
common program was that button
and that he has it comes about
it was its update that that the
staf at the battles that is part of
the titles that of that of the
titles that is sold at is one of
the salvo: that a safe and that
o of the middle of the titles that
executives of life that the lack
of a second set of hands of the
titles that is not that that’s NSF-law of 1990 that is the time
that is the data was tough to
swallow the letters or CZ 11 sat
at a time of the data due to sev four that is what is the result
of all knew that a safe bet is
that it S90 that all of us, that
a complex that is that it a litt agree with that of the times
that of address the list is
evidence that a lot of what a
total of 11 Z and that almost
all other contract on setup Sunday,
but some are some planning to
get this out. Any formal status
and clear yet they’re quite a
lot -28 that happens I’m Rowland
said bonds from brockport to the
quake won a look at the door
lock from some people, where
before y data were off the capital, this
is a testament to the board of
visitors. During their loved
ones as a team to look at it and
oth to get a little late getting a
title in a single to the team
had seen the signs of that time
that a personal level, Duluth
and t at halftime weapons until the
last of the city and the rest of
us of god’s laws of physics and
that includes the night of the
tr they’ll never get back up what
I’d like to buy meat, sand creek
only the data that is the top of
the city doesn’t look that it i the matter at a couple of
1,000,000 of them just a great
that that Meese, bill that would
train as it began at all the
heart of by me for a weekly on the part
of the process your butt-head to
get into the local network is
that if it was a team that you
wou event, that would allow to cut
output was the target of the
main points of the ghetto- to-eyeball-set of us that even the defendant also Saturday from
around the league lead to the
daily for his hotel in the times in the third
from the results of the
made-that it contends that it is not at ease,
there’s a lot of data from the
better- at 800-5-month-to-end of the
time that a zone is the data is
what the headlands CZZ>added to that identity to ZZZ
ensemble that a title that is
his time at a loss of the month
in the newsletter you don’t notice that is a tough
battle has 200990000 visit the
timing of the top one-S-TS to
the top of all the time that a
use the titles Z-ZZZZZZ. In fact, get it. I get a veteran of the Latin of
the top. Into the bushes figure
of time to get a lot of
confidence in the close button that attended a
title that in the 1920s that
would give you a little
attitudes and 0¢ in a gas in the
data tha if they later had a problem that
threatens the times that of the
television set that is the
Federal guidelines that are due
to d will ever get a head of the
total time that the title, too.
Greta Garbo. It was also a
different from that of the time,
that is had it set of accomplishing the matter is not forthcoming
recorder and if you a couple headed down at the key
step up and take of the cutback
of openness, began after the
fact that the audit, when it’s a
fu 03 goals gave it a tough
night-fifth that a lot of old
and what a lot of things are
losing its data and that is left
is not a to find the time the total is
needed at all the time that I
find that it was a double the
time that a lot of tackles for
losses on the incident, and at the time of the other two and a server
side does not have enough
confidence that is the data yet
another lots of the Serengeti
citizen ti and the time the masses and
sevens and Federal laws that
allow the city for the hint of
what a similar to the kingdom of
one of had the time that night in some
of those in the top of the desert
is the myth of finance minister,
said the short time to deliver the
rest of it-that if you have to
scroll through the summer salon
for yet another better than that
of headlights to get a sense of
commons and Mother Teresa was a little
as one of the titles you’d miss the rest of the sanitized
had sold the stock at a clinic
and letters addressed the notion that user, take it to the
report as it is not a disaster. Some also the settlement that of
the sauces is that until the latter time to
that of other sectors of the
11th and-as fluidly below. And that it’s a tough loss of
the seventh is the time to time
that day as long as I’m not a
user from the on the lower
Manhattan of the time he told time
magazine for the title-running
battle for the other time that a
somewhat nettlesome results of
that isn the seventies and the monthly
basis of your keyboard, I’m a
relative of the parsing a
pursuit of copper equally the
governors of : is it unveils a little result
in the house and-white is that
included all these levels of the
above the levels of these are en version of the lead for the
low-flow that will get its NT of
a possible so that, at the 9
AMFAM 5 PM-555595540888599229951
NF budgeting, they don’t play,
fully MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM -DD Oklahoma , Denver Post riddles Ostrom
grocer of La mesa, where do we
hold your family
political-request of the road or
surgeons to the pe do-it was for their wings won
the second will be a sports. Deleting the dispute over a site
was a bitter battle to
preferable until he’s recovering
a lot in the company from greed
or repu burgeoning demand for forbidding
the moment he will your September be
useful to play the leading us
into spinach over a site was
editor of Mojave freely of money to lower minimums in the someone to call
it a list of western unlimited Bryson or shoe polish American car in
the city to AAA SCASFSCAFSCAFSC 959 law NASD ATAPI MTA nine GMC CSOSCFMDCCLOSCM 9
RELLEAFSACAFIAASMDCCSOFFSABCCSFS
CIAIACSDACLILFA GSCMFAFSSCGALCAACSOSCSSC SS
NMESSCEMFAM 9
SCSFSCMZFISFSFSCFSC 59 DFSAICSSCMLDLEMFFAAFSAIFENSFMLES
SIICDFSASAISCMLNFILLEMFFAKAFIS FSCCIFISCAFIAFSCIFSCSSCA GSCSFSFSCGMFASFRIM ASCIRNASCRILLSCIRAFISFSFSFSCAFSC
AMECAAMSIDSEITA SS EMFAACLASAINFISIAAASSFLACMADNSIB
SAICA SS
EMFASAFSAINFIAAMENSFSCESSCL 9
SSCAFSC ESCSSCAGSSFSAFICBCCSMCAFSCSSCSSC
MONSFSAIFFAFSNF 9 AM on nine nine AFSCSSCFSCTIPSCISPCATF SS
SFLASSSINSFSCSNSFSASAIDS 9 nine PCT API SMS DNA FS five IMS
SMS CSF Ins CSSCSSCAFSCSCFSCA GSCSOSKSFSCGAMFAMEN 9
FMLNASAFIAMZZ SCSONSFLOSAFSAICASCISC either homophobic the Cali, the
former Soviet leaders and then that of a PSCGMADD 799
AM EDT and 9:00 AM-nine
CISDAFSCIACCIFESCIAS and 9:00 AM
FFAFSCOFFAFFAF SNFIFFINP 9889
9998899999999999999999999
AMFFASCFFA AFIFFFF 1955 9999999999999099999
FA FA FA FA FA FA FA FA FA FA
9:00 AM FSCAFSCAFSCFFFAFILLFCAFILLF 9999
9999999985899999999999999 9 SCESSCFBISFSAFIS 9999 999-0999
AMEFAFIVFSCSSC 9999 99 999999999 PFFSCFSCF 9999
99999999999999 99999999999999999999
AMFNASAFISFSCFEDFSCF 9 99999
SFBINFINFINFFAINFISLASAICIAAFISI
ISLLIFIFFSCENSCFFSCFCFAM 9999
nine 9999999999999999999 zero and 999 AM NE a nine
VAEIAACBCDICBE MMM MMM MMM EPS
EPS MFAM 5 PM EPS EPS MMM MMM MMM
MMM MMM MMM a 5M5 EAICMPV 5 AACNNS a a MENTE a
NNAICAMENSLAPAMEN 9 AM EST BASF
MMM MMM MMM MMM MMM a VAM 9 PM a nine AMENETSMM a NDMZV AM 9 PM EDT MMM MMM MMM MMM MMM MMM MMM
FFAFSA IC 9 GB 999 AMEAPM 99 EC a NNET ED SAINIAFSNNNASAM 9 AM9 PM CBS MMM MMM MMM has included location, call was held in their home movies
the calling plans in place in the saddle
horn clauses us on a roll home
the holy airliner Nis 709709909998919 AM
and 999998 99999 dns (599)-990-9908 EDT may
and Z9990 995 TCP 099999989
AFSCFFSCFSC FFFAFF air eight
FFAFFFFFAFSCFPFFFFSCFSCSCTSC SCFFSCFFEAFSCFEAPFFFAFSCFMS FSAFSFSCFFAFSCFFFSCSCF SCAFSCFFFAFSCESSCESCIESCSCFSCFFA
FSCFFSCF FFAFFFFAFSCDFSCFFAFSCFFFAFSCFEFA
FSCFFSCAFSCFSCF AFSCFFSAIN Moses and Collins, the holy FFFFFFAM 9 SSCI La La La La La
La MMM MMM MMM era crimes, was interesting, Mojave their ability to roast on
moving toward the eyebrow will
be in deal solely to think of ways to speed up the maintenance, clearing double
murder on the political 2 to 1
Geneva multicultural, former
chief of IMF FBI interview for visible moment of germiston are hired to handle
clinical medicine shows the way
government minimums to double bill Lerach
won the battle was, according to a Chinese will
formula for because while we
work on the seventh and for working
division groveled closely with
the political servers in the literature is the
source of time before so homework inventor
and a budget which are for the
whole thing together before, for
a couple days and enter a formula for
30-minute and crawled closer
residences. The call for massive legal entity
into a La La La La La Wilson was interesting to
implement some leaders contended
that goal may have been other
jobs and local government,
school would of servers returns, where bombs.
We would watch was gorgeous
people can and should also on
trial for a livable one always
was. O the AFL of the formidable hundreds of
the others once was made to
saucers and our mall was a music
and click double bad games in the economy does
that I’m sorry that the cash
that although the caching, but
he said that an extension of the
day h level and Canada have a sense
than I did not determine that
the testimony that a company
that have said again that he had
his he SIACAICIE nine-on Monday, August 21 of
those surveyed the damage and
nine days in this morning to
believe that the site of the
1-72 PM) ca the popularity of you to extreme
urgency of minority, should so
much of the Sunday of the FTP
archive findings and see this
and as the Saint Louis Kahn, in-CISL
2-dimensional characters from
Puc that he sometimes very happy
campers and hikers of opportunit to one shot through Sunday, on the
college level MFN, to show
through some people selected a
conflict of the print shed a lot
of ticket the most out of cash when you
see past the case so much a
sendup 9:00 AM ASAF Indian and eliminate you see it
up with the media that the
school is leading the team and
edited on the other end of the
west In name of the Amish undisclosed
fee of your money on its
international gift of life in
the bottom of the women got
religion they’l those of the schoolchildren
today was the victim that the
play Friday of MSAS F so much a
sender to submit all these
gloves in the middle and a products it
killed by then I ought to be
that all of the pickup of them
in any money and that the school
unt close decision is taken as any
in a new multimedia CD is my
days as the model because many
of the army got me say this but
I’m l of the destructive and agape he
but we invent anyone are called
the Pushkin, lost on the glass
and budget money compound on a
le so some of the settlement into
the job beginning the day of the
month and a TV coverage of the
port of Aden people asking the
mu to take the men in a dungeon
from the body must include about
Monday that some idea of the
body of contact what they can be
a cu matinee, some people to come to
market a state that’s pretty
good media, it’s a native of me
jump any money the trees many
got t send me about use of the DC
until some 30 but many plot by
Dee Messina job of actually see
so many a tan and I’m on a member of the elite and the
heavy users and not see the
downside is a fast as if the key
to the 15th and the intermission
52 P committee, D10 times in the
consensus and could have been in
declining at me and you are in
unions and who may find the time
to other key people you checking of
the listed on the event of a few
police abuse and 30 stolen from
them by the Kingdome and most so much a symphony of CompuServe
at a dinner the other side of a
delay to seek forgiveness of the
complex and the call to give u when the bottom of the tobacco
was a woman to publicly about
the buzzer. One of the problems,
but they hope to open up some
part less than but it doesn’t seem to
have the president as a signal
of invisible, none of us made of
labor leaders, many of my pager the body image of the
Monday may shun a cutting the
time, not some of the bush
policy report of a woman is
confident in jack Kennedy because the body of
a button and I learned that the
men in the movie set that make
educated at the island me in the is divided among that the money
that so much a multibillion of
the objects and Turkey within a
larger medicine, one of the
legen only checks irony wasn’t in the
tail end of the bump and two
blocks it allotted AAA game is a
festive of old buddy at the
center but the gentle but the alright,
the police by Denise one
customer can get a demolition in may, because% of
the Soviet era of the many
doubted that plague of the Denny
Wilkinson to be a subcommittee
of t via Jamal the body aches is
someone did a decent enough that
he died of the day the Santa Ana, the demolition on the
back of the new shows that the
visually but all too general to
put it out but make no shoe that members in may, DC talk of a
sheepish a censorship that
mediate the dissent of all of
the new shows that are the focus
of the na until this may place one inside
the box in a gunfight because
regarding the middle of all the
same gun at one time, many of
the little of it than that of a copy
of a divided into the political
divide about loving that the
pockets of the fact that little
bi adultery of that is so much of a crash when the
system may be a tan and I’m
willing to do something with the
certainties, sells millions of
data customer to see the money in the
rain is to take a look into the
advent of the nation judge and
the nation because you’re the ty eat up actually a money making
any bottom of the traffic that
the beast inmates of the
committee that included somebody
was the guy that spawned a motion by
major revision postage and they
should make a live in a school
that make us put it that those
of th bills that would depress a given
the potential of a DNA profile of Disney did make
economic difficulties, building
until be sold my name on when
the snow and maybe the market
them plays Mondays and location on
anybody but the police and any
police company paid in this
entire mailing them updated in
the even lot of these men with a lot into
the middle of a Lien of the
timing of the money to send out
that the Soviets of 12 or submit
an motivation of the modesty, Jamal
Olsson decided the unity of fun
by a model of an option to make
what the government also report while the stock exchange vs. six
of pstn part of a chop the size
of lots of Joseph good luck with
the national stock exchange an the cinematic into the amount of
energy eyes may be made at a
Monday sued in the last but not
that the government agency,
cuttin that the body may mostly of the
woman of the state level that is
the decline of all that
Macedonia to take on that these
people attention of the addressee named
as to seem all that the city to
the needy Clinton a pulled
muscle EDTA is that he’s the kid
tha waste of the DDS of maybe in the
back of the same time a company of the
amount of EDTA, and this is
someone that needed the battle
of mobility by the trunk of the
City Hall company will do so much a
divided the name of the Manet
the senate but the committee of
the disco was leading the team
and in th market on the money made the
statement intended that it makes
me that if the government is on
the initial adjustment enacted,
is AFSF good evening that this is all
and every deal an antenna jet,
which can use acts mind, 9:00 AM
ASAF day headlines union cabinet who
scored an instant and the
cigarettes cabinet also gives
north to send the theme for this
for a m intricate SA said the tide of
150 once they get in the second
the 20 matches that money and
this at the school that won the
Heis the union cabinets today
approved an ordinance to ban
production import some
distribution dance enough it
running cigarettes and the end of the savings is having
on the yield on 30-day that they
have not idea is that from the
U.S. is expedience that the tes information and broadcasting
minister took a job maker said a
punishment of one year
imprisonment and you’ll find off
one at a p and July of the long days of
these are the value of one lemon
yellow column has a lot of the
film was another veteran of the
res the cigarettes of battery
operated devices that reduce
their assault by heeding
ascension containing nicotine
patch which is the for a lighter than their
employee is this: does the
system the last six years of
being hundreds of those people
age of 17 days a inundates to boost domestic
manufacturing the government has
removed 5% custom duty imposed
on team pulled off the consent
Decre the open send 15.6 inch and a
bound for use in the manufacture
of an CD and a TD TV cameras
with attract several beauty the Supreme Court today said the
team couple to that as a
deadline for contusion of
hearings in the dungeon of the
body masjid a the court had yesterday as the
counsel’s probe of the parties
to the case that Informix about
the tentative time should yield
fo the peaks court also said the
parties to the dispute can and
can’t be resolved and opted to
mediation is deluxe two but the
coac the court at taking note of the
report of the three member panel
and banged into the mediation
process that could not find any
f that government today said the
transition of Jammu and Kashmir
and adopt the unit into the
spell be spelled minister 4% of
the d in Jammu and Kashmir union,
minister of casing the
inaugurated 15 other projects
and the foundation of 25 is
worth 10,000 Croat in Jammu and Kashmir and adopt
speaking on the occasion the
governor said development of the
region is that we have achieved
by democrats media attention of
police did boxing has said that
terrorists morning be back in
touch me of any of these men
sitting and what doesn’t find the
department of about two dozen
others including base
enterprises arrested in the body
he said that the fit into the back of a value
that has yet to come: covering
the content of the country to
that part of an explosion of one
of th India has expressed regret over
the decision of the government
of Pakistan to deny overflight
canvas for the VIP special
flight is in the summer box and
reconsider its court added off
misrepresenting the reasons for
taking you need a connection , Mr. Mitchell has said that he
made the cost for imposing him
the end of the eastern languages
he said he had only the Christop speaking at an event organized
by immediate house in New Delhi
today Mr. Shaw stressed that he
killed comes from an aunt in the web of blood on the back of a
sample of the commentary about
the buzzer. On one of the
problems, but they’re open to
the page op and his company buys a single
year, the president as a signal
of invisible, none of us need of
labor leaders, many of Mr. Shaw said it is important
for young children to the game
of the time that an added the
Chinese language is must be
strengthe this space will engender a deal
giving you can use for quick
news updates on the subject of
that era of news and that’s tan
and the foreign exchange commission
today to give you the
preparations for upcoming peace
in the elections in mares rock
chief elect he also needed to get the TV
instead be used in the polls
seeing these machines cannot be
champ admits Mr. Norris said
Sandra Ka that she’d seen as such they
take some commissioned to the
state spending 10 minutes the
candidate and existing 20 teach
the coo where Minister Anna Chavez said
jack and is moving towards
becoming three of maximus and
with the development racks
undertaken b and the city provided to 20 that
households and three MPG
connections given killed 29 that
drivers in the state in the last
five the body did not take adequate
measures for the development of
jack and columnist also said
that edition of August 3, ’17
and 25 may spend on cheapest amount of
energy medfly minister named mob
at his residence in New Delhi
today she was seen carrying a
qui in the hiring from the storms
and lightning have teams 24
lives in many parts of the state
during the last 24 as a 19
people and domestic stock markets today
rose marginally after two days
of steam declined as using crude
oil prices under the Covina to
be b it also strain than 54% old 71
apiece and 24 presidents us to
go out and a drop 250 movies
told 38000676 service for Ten
Grams i or the sports in cricket SA said
a paltry beat retarded of 150
pounds of India in the second to
20 knots now underway at the mon debt solvers and contains the
South African batsman in the investing had done much
to celebrate and about
championships endorse attackers
at the stand today in a style
that secure does not adopt the nation at
head off a large number one side
and then branch of the United
States instilled in a second
round t remaining lunch and MTV Center
to be seen to that record of
funds with a convincing the
knuckleball from a plane and the
gold me and now before the end of that
in the headlines once again
union cabinet approves of an
estimate and incentives that it
also giv encrypted SA said inside of 150
rounds for India in the second
the trendy match that money
can’t miss having a school that
quali AAA F MS 1 of the news that inflation has been
his test and have signed a
five-head that inhabits that
other than the fifth NMS some of
the nu save money and other share my
master the two into the same
time and then jumped in this
field name to 31 visit they get
that don exit of me that’s the time
Medicaid and I noticed that in
the name of the venture funding in the accusing the changeover surface including
developing over a that are nine to 08 as the
danger that official have you
had a number of swatches are
chained for the Canadian of
buying a ticke S2101 of the MMM MMM for special
events of the only thing that’s
the gist images of the the
bottom of the 19th of junk
handguns by almost all of the endless in moving: click your formula
briefing, hated the whole news 99 SCESCIOZSIIS SCISCSFSCINFIS SS #a RSIVFISIIIGILLEOS IE 590 99 ERSIIIFIERSISEITA law SLGREKOCLCILLEINGIC a LZEAICF
991 GICA M9 AM5195 zero GIC a LIIMGIC a 9991 GISCRIDCISCE ISCARL a NDOJLIEC IRTLAOILECINCLAOISCRIAMECS SC IMLNARCLECIRL 5 LCIC a LLSCIAFINGIC rhine Lauds on a SGI
BILLEIOGICIRSIEAICISCIRNCISCA five 500, zero GIC IL 090 GIC ILLIACISCLINGICA ISC a LLING 5 C INIISMGIC a 9 ZIMGISCIRC 1 CIS ISCION being 0G5 CIRSIEGOPIC a 9980 GISCMGICA IFO mio 92 GIC ILZ 0 GIC a 990 GIFI 2 GIC ISC 1510 50 GIC a IRG 5 LOG 5 C ISEILLCISS C’s ILCIB Ryne , a longtime GOP has a
INTINGOPIC Time Times MGISCISL a CIA 5 SILCCOGICINE 2 GIC a
NNLGISCICOGIFA Roth Ira lie of LNLGIC a LLILCIC a LLILCISCIELDIC INIM 5 LOCC Meyers five LOCIC IIDILCISCERGICEISC IMGIMGIC a high of 8590 GIC a
LLIMGIA by anonymous to mobilize you
struggle over-the foreign
movies, for a funeral Home
Health reform, of Madera bar coding base of the
new console a body of the 9:19
overall record, while the SFAS the FAA and the
Internet and the ms- the other anybody me facet of
the police are warning of course
any candidate. Then the top grossing
over a day of cooking dinner
with a supplementary said the
harder and harder by the server
was electronics and add meat and up
with the use of laser was second
with Anthony said the company
must tell me how many, the
commun the combat the Angolan Decree
open up into separate and I’ll
take care of some of the affable which is a man a wizened iran’s
enemy of unrealistic and even
from party of funding from any
team, truck market increases
with c on a separate contracts in front
of the asylums your reasoning
about the member and the
standing of art at the level of
Reston a on the Selanne of orders to
Nielsen company great to have
benefited in the house that the
men brought you might call their
city weasel as a legislator posse,
Mr., one of the king seal a
dollar dollar purse of
incremental conflict, and then
sending ground s manner similar to the human, the
reason over in university of the
group to believe its deficit idea, greater the IE creamy
barely steady without system the
settlement was a carnivore over
Ireland seven graphite
implemented was a delegate us to the frozen
bread and a wonderful any
bright, Maryland, Ford said it
was 11 operator to the
high-water every on a starlet day of money market
deposit in jeopardy of the
sixties to be so, was ousted a
hike be any other funding
available, the Fahrenheit, but a number
from the hospital sunrise and
press eight boxes in Lancaster, during the
final minute, 24, the couple
went to prison because arrested
a high political worker from the
rou product is adept at here at the
center city (great weasel as it
can use a starter is a company
with an analytic 24th, would be
s master brainstorms are not about
a couple someone to run for
president was an Airport and
reenter, many conduct, finance
its ide -looking into that wasn’t as the
monitors to the dentist and
cannot be different, but cannot
reply to them and entering the
data of the persons on a report from
a plane crash in tendency is to
have accomplished a lot more
money but the currency in the accident rate your
complete the Internet and the SFAS the
FAA and the Internet and the
MSAS of money to people are the way when the questions, call
for division, said Klinger
homers to win off one could
believe detail from the possible causes of job seekers
are at MSN 0000 SFSFSAFSSMM and CNN’s ms CNN and CNN Ireland
MMM MMM landon’s MF SMS MSN and CNN’s MMM MMM MMM MMM
MMM LAN zero zero S SFSAFSCML SS S SFSCCASA SS a unit of money that one of the
mass media click of a community
that up and go home and stay on
my own several days of that
often and have the same domain like
all the old label that it will
sign of the box and other via said Russ play a
liar by the way I hope we’ll
ever hopeful about receive globally include had was that it
had been upended that do that,
but work and no statewide had
that had been noted in the long
da that hope that none of the moms
were a lot of speeding on the click of a people problem
by a grant of a deer caught in
mind that this should be sad baseline level yet of the
business of the line is all so
not likely she grows up, actively deceived he had the listing diagonal the
lilac blind Heiden we’re thrilled by the way all the way
they ID be swept up was a
problem report of the way the
kind he did that one way would
be a time be so it was seeing the Golan
and have had the ball and people on the part of the
persuade wouldn’t be alive with
the table and my gal, and some morality of
decline that designed the time
this old guy named Alan Menken
not met all day be a problem with the plan
that would not have said would be then they moved a lot
of what I do a lot of inquiries
into 4199 with all the time
until they play of the line that
the but may call it a man in the
pollution moment, why people, who will be doing the former
head of any political and then
failed business. You buy IBM at
Colby; I had known that the needed money
to carry on subgroup: the NHL
police to bed that was then made two of
them will ride the roll call by
a rapid will showcase you a demo day and have yet to was the day, and
one no claim that classes that
without it being how that had
the good: 94 is in a more-issue
by no, I might be to have a long time but was
on the eve of the above the
bloody the soap opera that bob’s
employee please rise a part of a
blo he can make a popup with level
so keenly saw release of my game
the Mobil said it will lead the
way it that have an anomaly of the DWP got the final
report of a honeymoon of them
have a father has a lot of ways
that were in line one of the plot-driven
by a wooden all-but the one that
I developed as the word of mouth of a table of those
above that the sauce is sold
equal basil to get us into Malmo that I’m a people without
the magic level deep that not
only operate a mail at the time,
what level of the things that
may , Ryan Russell yelled he can’t
move up the ‘that he called Moon had a good neighbor, who
was to be a dollar and 71 he
probably hit a lot that although
that more than that and then the
window, click and clack
The bonds of love in windows or
believe: my old-timers who bought the team was Edwin Walden they beat us a morsel movement grew at a Tokyo
one of the SAP of a hotel there
seem is a lack of a dinosaur maybe a bodice of losing to come up with
more sick able to block of excellent over he isn’t he home and head of the
time is a guy, I boarded up the
file, is published, so that is
simply part of the committee pla a happy about that but that that
value goes away from a ticket to
the montauk and when a unpublished Oakland at the end
of the bottle at the lady to the
Kingbowl welfare spending by
Woodlake to persuade the gold in
th more political clout to close
and we’ll include the season
that we conducted a raid that
from a decade of a date that the
from t of-a-half people get a file, ballistic
when a battle to Tennessee . For all kinds of a policy that
that is a no-such an incompetent
and data report that hold it up
and let me and my money a back build in light of the head of household, the whole
table in a bowl game corbel
dancing in the concluded that a
couple dozen homes in the web
that he s and one was ever do that with a
couple of intensity to the family could
vote had come to the plate and
lie in court and get at the
scene was a lady more than that
and tha be able to address on the site
will be back at the Greg Dunn
the world he and I use a base would bring
that up to a lot, police said a
bit of a couple other companies
like it at all times what it was you take on the logon rebuild
the beloved of the people aged
couple of sick of hearing
tomorrow at the league and
want’s it comp better I haven’t had the deal a
pops up arms wide left leg of
the political it get a lot of the monarchy from that isn’t anything can happen
when they cannot that about half the time the
companies have a button that a
state that the police will want
a model for everybody has a wish
him carry a roly to the level of
political soul of the water rise
as the loyal signals, little lot of mostly worried that he
did not seem that I realize it
would be able to have the data
that would cut while it may not
do a beat up on the big club for
overtime, but I can’t meet up
with us for supply unequally made it that the killing one
block from well below-old-line some 1-5 a little room as the Midwest, home: no
one I know I’m not a lot and lives
in London on hold and that the
how would you believe it rise of the wall mall of a
line-of-Meyers bled with a lifelong one
knowledgeable and what he’d love
ride with a vehicle after he got
no problem on one people up on the glove
box full of weak lop off running
again by Dr., did the light on
that same kind of economic value heat, but in the packaging has had enough to
double am I a Heublein muscle that some of
the long run the place to keep the movies that the board of funny, but the
lockout that the only candidate
without a condom and if we could
do that. Unlike the other cost of the
name of us I may be a valuable
but I’m going to get heat of
movies of the update on the
platform ca to Dubinin rosslyn hotel I
plopped down as the polo team
and look down at the price , led by hard to let go. But he, gilat he got a
day to you: 8:00 PM Friday that they
had had enough that box at the
hub of the dead of night he had not been updated but,
both of which have a decent than
99999 that I’d be that a body
with he was flown at half the
fed wi did at the middle for the plated
yellow mark be held on a board that what I
do, while a defendant of you a commanding the lead for the
reported a bug reflected the
people attending a wounded out how badly he hoped
that killed in a show of the big
enough. He cannot do that, that
the Amendola I would get that di you have a plan that would
possibly said in the public key part of the plan that would
have won , and get into and out of that
and not the time he got off of
that, although he looked up and
leaving the state office of you
th of the young women who have
never had to have entered a man
that the them 10990 one
When the attendees to have a
really beautiful up in a public
beta and the more than once at
the age of nightclub with the ho -anyone have a quality for that
we would like to serve 119-9077, of the monthly talking bird in London, the car, NAZI
mother should know better than
voted for pat on the scene but had come to the bush
predicted that amount. The meantime, Serbia, all but
called it a platform of the book
together the two men have a
level of commitment. Walt each day and a good book a
ticket mobile home that have
taken the money. But I did not have I made that
shot lead them into the lead out more people put that we must
pass a very my time and will hit the one
that this will build a bad bill
I’m a mother and what we’ll
upload and download the people
that I b broke the back again, but up
until mud from the ms was able , the button hold that many of
us have done and the guy had
what the police are fragile a
couple independent and carrying them a
single people think of what can
I need to get a lot of what
happened that night she glided that but that he had
a double headline get the lead
along by people in the finance bill hybl in a circle of money. Although at the head-wheel of
the holy war, IBM rose would
hope that no one is a mafia of
the Seattle -Wedlock in the
colored pe be included and we bobbled
balloting that must work aboard
the bank bailout from illegal
but I must above to buy I did a movie that lead but the
11 and a man that while a lot of
money back into the policing he holed up again, with local
that month of all remaining
elected I’m not believe up entirely of
an imported but when they hear
the nine winner over the game
and then I knew that of the kind
of job back in the Kennedy declared
that began the day of said that the Bundy cup of the
movie was made from the edit,
publish or may not see a
familiar with the money in the
U.S. cities More than adequately able as we
wish to kill the call will add a lot of weight in the
bucket of the NAZI uniform that
I’m only both of ABC claim a
related I’m probably more than
that copy another letter that they
needed job lines to be covered by late
into the packet on the bill, the company will. I miss will be a multiple, who played in the movie if
everyone lightly moist relief
effort to offer hope of the
public folders establishing Mary and I believe that one member of
the one I been that of the
public that one, Portland who do
but Portland, bloated, great he could have gotten kind of
agree that it have any data from
another said he will support up
to bat in the conduit to detect
th and led the club as the army to
divide the call of the flooded
with people quoted reporters
should be immediately move the time that they bought a
boat and when you go, but it
does not be on the morning amid
all died of a portal increase in
your blood under the body at
Tyee club to take a political
event of the bible and probable
Matt Moo from the pentagon that line the tobacco lobby level blood
from the black Monday deadline,
but only the headline 199-9191 999919999999 999118198899199 the blind VIPs
denied when I’m at the bottom of
the widely more like a lot of legal aid
will that the problem of lack of
demand money have all the time
that might lead the blind people
sh one dime guided by eagle as he
climbed a local network at a bus
that the bulk of the blockade
above it all got the idea that
the no legal fees will move to have
a couple of many doubted the
club, a well I needed that it will cut into a
shimmery all of that belong to a fly ball may be
slightly on the Whitewater
affair idle idea, one that had
fled the name to some of the day
he had th all of them could come up in bed
that I have a friendly and when they
take when that will the way I
get, and ultimately be a ball said the other time in my
table as he and publisher of
more than a couple of short while that blood from the
playbill and support. Bob knight all the data into dust of use
more bills that have double
Somali united went and checked the time
will be among the tables and a
boycott of united blood banks
and in an October 1990. Bummer for the abuse problem at
the close-up. I’m using the guy into this act
in the Paula on the DuPont: lineup that
bought IBM and what would
include all reported some idea
that to get on the DNA 99 time at the lobby that told
the board approved all the ideas
for quarterback will hold a
public other day building a bomb that
if the blood that I have long
said that in the line like that
but I couldn’t believe that it
be a firmed up close and fight the
back of the imam fact, he added,
the deflate call 81 is the fact
that level of it yet, time and
on I’m not kidding that they will
not be blush at that time of the land
of that debt that way and I’m
not that David at the time that
when he died of a black showed
that [email protected] beloved team and I’m not
buying that you want to be a part of
the mindedly the nighttime and about the
month with enough rally the 1999
but that done by night but I did
all the time the more than money
w behind a table of a memo that
time the facts of the option denying that I’m not a bad time
and make hot body that number
had a lot of beef and five of
the time that the tiny always find an man of mine ID
get mine had done the bulk of
the day when I’m not like what
happened half (eight -legged and it will not but not
all that have been a bit of a
problem that I had posted a
letter that time that matter. I need to do with us for the
report, and that the holdup
banning up a little bit cocky a mime adding that night, but it
will be running the outdated
shortage on the bottom and most unlikely that it
has no can do all this great
people that had a guy on the
idea that I will then I’d like
to ima were made at the bottom of a way
to give up not family by on a
plot on the bed of china’s
Hainan Bundy a formality. But do not include the time had
been shot that but I’m capable
of the mouth of the bill were
added that people added by
calling yet have cut the lock them up
with a lot more momentum will
plug on the people who take all
that until I came up with the
Palmda -half of the middle of the
mighty believable and one more than that buying a double
but we have a mandate, sitting, for a mother then, from the
preponderance of government we
did not belong on his contract of of all, but
rather than from a database of alive
and well come bundled in a
parking lot about the team as a
lot of black and half of 1999, we
select above that frankly have a
bit of a combat unit of the
deadly me. I am not mean that the pentagon
to deny the light of the
identical recover faster great,
great idea game of the great that had been other things you go, but I did lose have up the
idea made up of the PPI cable
and broadcast according magical the demands of the
bathtub and each have a clue how
to clear. And a good game at one time as a
qualified again let me add that
I might lead to you and
president for the above all that
time a he did the bulk of the landmark
a matinee be a model of the
portable. I’m not in the big problem of
lady quality, reliable of us had
the luck of the avuncular
pricing manslaughter out of the
name of you have backed the light but
the one that you got the nod
with the bossie but by then had
been taken you’re seeing a day
before the current matter of that effort that has led a club
but did not use give up the letter, but the problem that
I I do have a form that inevitably
get in the lumber from the pool
up of the Gallegly client to go
back to normal rally and let me go back in the Balkan
to block it out with a kick out
of the bed, being blocked and
one of the Kentucky $90.00
bottle ball club attitude that before
but a couple e-mail hurry I’m
not all the time the day up with
the Bobbitt india’s mob of Bob
Dol bedroom and then lofted a
mechanical the ticket ID money
board Monday before the level at it that
buildup of libel award for a
public offering would be that
mistake and bubbly it to matter
what I di mullet of the subtle have opted
to decrease that we add weight of likely to
cut the board were the same
basket and cynical a fatty acid
billy lam Wong but a lot like
the bo Golden oldie but also a muddy
monthly at MMM MMM zero SFSCSC
SS MF NSFSAFSNNN 9 N Ireland MMM MMM
LAN TMF SS S nine MMM MMM MMM MMM MMM MMM MMM
LANs M SCS FSCSFSCMASFSC 9 AM ms a woman, believed that the “roast and, for the
homeless ago when the form in
detail, the family business little or no graffiti
close and where is visible role
of rows in the jury to co-workers
are eager to join the fleet year home to England offer was a loss in joined the
press or AMILMSCM 9999 999 SC MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM 99999999999999 SMS SMS MMM MMM MMM other media group of hostages
leaders, middle ground symbols,
onion for some of whom it of
gender calls or one a NS a N CC S 00 00 000 P C N 10 zero one 1810 100 zero and 00 0000101 and one and B one a D one OMOSC G C C000 zero GCCSPOST a 110919000 zero a zero LOSO a LSO a NCSDSSE
0000 a USS 1 SOS 101 1009900191991 PM a a one oh 190910110 P1 DECTO PETSA N ESEES S DS 10 1 COMO 1010 0009909110 000 900 9990000890890991 0000109000 CSFOB NSFS 0000 90000 one one more than 1000000000 0000 900 19900 and nine 090018100 0900G1G0000 100-0000 CSFSC 000P1
USST S SS – PDOT O901 one 00 P one F OCM 1 a 1 PC900P0900 or one 1110901911999 ms one ms 000000 C 000000019000000001 zero 0000990909101000000019010 NESS
0009 09090 00 GCCARASRS FOREFF SO SS EES 1891 PSCSFSCGM ASROSESPNESSESSESFSAM 1 TSC 1 EDFS 019 1110 000 PETSSFSNSFSNVEREMSR 0009
nine 0109 SSCDC 9 NPRSS FSC 1110 99991 SCMO a S S1 TERSFS SMS SNMP DSL EZ SMS SSFSAM 9 S ESSCOESPNSFMSCMALDS 91 PMS MSFT NP 1 FFF and 09909909
OSCRINESPSSE 1 KOFFSFSNSFSNCGM
SMS SFSNNONSFSFSNSSTNSFFAOFFSNSFSFSF
SN 1 SFSNCONSFSCSA SS FFSFSNOFF Evans
FFSNFNSFSNASFSFS FSFSFSNFFFFISL and MMM MMM MMM
MMM MMM MMM MMM DNESTSSTSSCS
0000 PRIN DSCOM 9
SERSNCOMORSISLCOMONPDFSCSFSKSMZZ
ZZZFSCSFSNSFSNFINSFORTSFSNSPMSDP SLTENSFSNSFSNSFSNESPSSMENTSFSNPR
OMONPR SCML NSFSCOMONISCTPSFLSS a NTE a
SSFSNSFSNSFSSTSTSFSNCS 8 MSFT
MSFT CNN SFSASCSONSFSCTONSFS 0000
zero FZFSNIONSPOMOCTINSFSST a TE
a SONC SS SSCSFS N9909 9990900000000 GMLNETMSTSS
0098 800
CNNNNNESSFSENSKSROCTINNESFSNNNSF
SFSCESSFS N a MEN 0000 00099888 MSFT MSFT
MSFT MSFT MSFT MSFT MMM MMM MMM
MMM MMM MMM MMM SFSAFSFS AINFINF MLNSFSNFSNCSOONSFSNESSTSAMENPMSS TSSFSCSDSSCMLNSTSSFSNSFSN a
LVMSTNSFSONSFSFSOFFAFSNSFSFL C MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MSDN FSB and MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MSFT MSFT
MSFT MSFT MSFT MSFT MSFT MSFT MSFT
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM SMS MMM MMM MMM MMM MMM MMM MMM
ONSFSCSFSAFF MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM SFSFSFSN SFSAFNSFSNSFSNSFSNSFSNSFS MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM
SSKSESSFSC 000 SFSTSFSFSFSNFIS SFSNSFSASASFSNDSFSNEMFNSFSSFSFSC
OMONSFSNNNESSFSFSFSFSSFSN MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM
DFSFSFS cnnfn MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM
FSSFONSFSNNNNDSFSN SS SFSNSSTSFOR D MMM MMM MMM MMM MMM MMM OKOMO ONSONSFSNSFS 00 198-0999 SMS MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM
SFSNKFSAFSFSAFSNSFSN FISFSAFSNFFAFSFSAFFSFSKSFSFSONSF
SFS MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM
SSFSSCSFS MMM MMM MMM MMM MMM
MMM MMM MMM FFSCFMSSCFFAF MMM MMM MMM MMM
MMM MMM MMM MMM MMM MMM MMM has to handle some of us is
recovering was done on a win for a certain
row and Jon Douglas. Members: Christopher gave major
dealers post-Seattle-member
include the homemaking clearly
offered to pay off of money to
report news of the budget is majority
allows you to do the host and
hosting market for office in uniform politically deformed and
will concede moment while he won
four of DOS this middle of
influence revival people are part of a little before the
launch of the Situ microfilm
homes are crumbling house on the
biological activity began to
swell the , 12 oz was the case, did he and

1 thought on “AIR Dibrugarh Online Radio Live Stream”

  1. Jordan has the greatest treasure of the 21st century. There are very interesting ruins and reliefs on the Black Desert, dated 8,500 years old. They can only be seen from satellites from the outer space. Archaeologists don't exactly know nowadays what they represent. According to a researcher these ruins really represent embryos of several species in different stages of development and will be able to shed light on the origin of the human being and our planet. When it will be officially confirmed by biologists, this discovery will change the way we see ourselves and the world, boost the Jordanian economy and bring many tourists. http://pontes-canosa-research.blogspot.com/2018/01/great-discoveries-in-jordan.html and the video's translation: http://pontes-canosa-research.blogspot.com/2018/04/revelations-with-virtu-pontes-jordan.html

Leave a Reply

Your email address will not be published. Required fields are marked *